RHESUS-VLSLWHTAB

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesMacaca mulatta LocusIGK TypeV FunctionalTrue Length302 nt

IGKV2S15*01: a Macaca mulatta IGK V allele sequence, 302 nt, functional. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Macaca mulatta (NCBITAXON:9544)
Locus / type	IGK / V
Functional i	True
Length	302 nt
Protein UID i	RHESUS-VP-ZYPPK4 (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

302 nt

GATATTGTGATGACCCAGACTCCACTCTCTCTGTCCGTCACCCCTGGACAGCCGGCCTCCATCTCCTGCAAGTCTAGTCAGAGCCTCCTGCATAGTGATGGAAAGACCTATTTGTATTGGTACCTGCAGAAGCCAGGCCAGTCTCCACAGCTCCTGATCTATGAAGTTTCCAGCCGGTTCTCTGGAGTGCCAGATAGGTTCAGTGGCAGCGGGTCAGGGACAGATTTCACACTGAAAATCAGCCGGGTGGAGGCTGAGGATGTTGGGGTTTATTACTGTATGCAAGGTATACACCTTCCTCC

Amino-acid sequence (V-REGION)

100 aa

DIVMTQTPLSLSVTPGQPASISCKSSQSLLHSDGKTYLYWYLQKPGQSPQLLIYEVSSRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIHLP

Published by the source, and consistent with the nucleotide sequence above. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (RHESUS-VLSLWHTAB). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGKV2-LF7B*01	IgLabel	MUSA
IGKV2S15*01	IMGT	IMGT

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

Name	Kind	Source(s)
AY963754.1	NCBI accession	ncbi_nucleotide

External records i

NCBI nucleotide: link GenBank: GENBANK:AY963754 GenBank: GENBANK:AY963754.1 IMGT: IGKV2S15*01

Literature references 1 total · 1 verified i

PubMed publications linked to this allele.

PMID	Title	Evidence	Source
15900492		verified	ncbi_nucleotide

Contributed by IMGT, MUSA, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
GGGCTGCTAATGCTCTGGATCCCTGGATCCAGTGCG	25 + 11 nt	IMGT	RHESUS-LAAND2

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/RHESUS-VLSLWHTAB/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases