RHESUS-VNLIIRN4I

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesMacaca mulatta LocusIGH TypeV FunctionalNone Length296 nt

Species	Macaca mulatta (NCBITAXON:9544)
Locus / type	IGH / V
Functional i	None
Length	296 nt
Protein UID i	RHESUS-VP-OYVIHI (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

Every name below denotes this exact sequence (RHESUS-VNLIIRN4I). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGHV1-RO6H*01	IgLabel	MUSA
IGHV1-AAU*01_S8392	RhGLDB+	RhGLDB+

Contributed by MUSA, RhGLDB+. See Sources & citations for each source's version, citation and licence.

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/RHESUS-VNLIIRN4I/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

296 nt

CAGGTCCAGCTGGTGCAATCTGGGGCTGAGGTGAAGAAGCCTGGGTCCTCGGTGAAGGTCTCCTGCAAGGCTTCTGGAGGCACCTTCAGCAGCTATACTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAAGGATCATCCCTATCCTTGGTATAGCAAACTACGCACAGAAGTTCCAGGGCAGAGTCACGATTACCGCGGACAAATCCACGAGCACAGCCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTATTACTGTGCGAGAGG

Amino-acid sequence (V-REGION)

98 aa

QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYTISWVRQAPGQGLEWMGRIIPILGIANYAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVYYCAR

Translated here from the nucleotide sequence; no source published a protein for this allele. i

API: JSON · AIRR AlleleDescription · aliases