AIRBabel immunoglobulin and T-cell receptor allele sequences · leaders · RSSs

← back to search

RHESUS-VQCQON3YR

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesMacaca mulatta LocusIGK TypeV FunctionalTrue Length287 nt
SpeciesMacaca mulatta (NCBITAXON:9544)
Locus / typeIGK / V
Functional iTrue
Length287 nt
Protein UID iRHESUS-VP-R6YRRV (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

Every name below denotes this exact sequence (RHESUS-VQCQON3YR). None is canonical; they are labels, and the UID is the key.

NameSchemeSource(s)
IGKV1-223S*01 IgLabel MUSA
IGKV1-JRTN*10 IgLabel OGRDB
IGKV1-43*02 IMGT IMGT

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

NameKindSource(s)
NW_001099007.1 NCBI accession ncbi_nucleotide

Former IMGT names i

Former nameLast seen in IMGT release
IGKV1-9*012020-01-31

External records i

NCBI nucleotide: link NCBI Gene: NCBIGENE:701244 GenBank: GENBANK:NW_001099007 IMGT: IGKV1-43*02 OGRDB: IGKV1-JRTN*10

Literature references 46 total · 2 sequence-in-paper · 44 name-mentioned* i

PubMed publications linked to this allele. A sequence-in-paper match indicates that this allele's exact sequence was detected in the publication text or supplementary material; it is sequence-level evidence. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMIDTitleEvidenceSource
32866207 Mapping the immunogenic landscape of near-native HIV-1 envelope trimers in non-human primates. sequence in paper literature_supp
39068149 Multi-compartmental diversification of neutralizing antibody lineages dissected in SARS-CoV-2 spike-immunized macaques. sequence in paper literature_supp
19563687 Isolation of a human-like antibody fragment (scFv) that neutralizes ricin biological activity. name mentioned* literature_supp
22111995 Isolation of a nanomolar scFv inhibiting the endopeptidase activity of botulinum toxin A, by single-round panning of an immune phage-displayed library of macaque origin. name mentioned* literature_supp
25338678 Sequencing of the human IG light chain loci from a hydatidiform mole BAC library reveals locus-specific signatures of genetic diversity. name mentioned* literature_supp
26382731 Isolation of nanomolar scFvs of non-human primate origin, cross-neutralizing botulinum neurotoxins A1 and A2 by targeting their heavy chain. name mentioned* literature_supp
26429876 IGK with conserved IGΚV/IGΚJ repertoire is expressed in acute myeloid leukemia and promotes leukemic cell migration. name mentioned* literature_supp
26440796 Development of Human-Like scFv-Fc Neutralizing Botulinum Neurotoxin E. name mentioned* literature_supp
28813462 A comprehensive profiling of T- and B-lymphocyte receptor repertoires from a Chinese-origin rhesus macaque by high-throughput sequencing. name mentioned* literature_supp
28974033 The European AntibotABE Framework Program and Its Update: Development of Innovative Botulinum Antibodies. name mentioned* literature_supp
29545810 Repertoire Analysis of Antibody CDR-H3 Loops Suggests Affinity Maturation Does Not Typically Result in Rigidification. name mentioned* literature_supp
29558968 BALDR: a computational pipeline for paired heavy and light chain immunoglobulin reconstruction in single-cell RNA-seq data. name mentioned* literature_supp
30530648 Virus-inclusive single-cell RNA sequencing reveals the molecular signature of progression to severe dengue. name mentioned* literature_supp
30697215 VH1-69 Utilizing Antibodies Are Capable of Mediating Non-neutralizing Fc-Mediated Effector Functions Against the Transmitted/Founder gp120. name mentioned* literature_supp
31839985 More than one antibody of individual B cells revealed by single-cell immune profiling. name mentioned* literature_supp
33048842 Antimalarial antibody repertoire defined by plasma IG proteomics and single B cell IG sequencing. name mentioned* literature_supp
33485405 Enhancement versus neutralization by SARS-CoV-2 antibodies from a convalescent donor associates with distinct epitopes on the RBD. name mentioned* literature_supp
34104872 Potent germline-like monoclonal antibodies: rapid identification of promising candidates for antibody-based antiviral therapy. name mentioned* literature_supp
34126625 Naturally enhanced neutralizing breadth against SARS-CoV-2 one year after infection. name mentioned* literature_supp
34242577 In vitro and in vivo functions of SARS-CoV-2 infection-enhancing and neutralizing antibodies. name mentioned* literature_supp
34244522 Potent and protective IGHV3-53/3-66 public antibodies and their shared escape mutant on the spike of SARS-CoV-2. name mentioned* literature_supp
34587480 Paired heavy- and light-chain signatures contribute to potent SARS-CoV-2 neutralization in public antibody responses. name mentioned* literature_supp
34788600 Immunizations with diverse sarbecovirus receptor-binding domains elicit SARS-CoV-2 neutralizing antibodies against a conserved site of vulnerability. name mentioned* literature_supp
35108220 Ultrapotent neutralizing antibodies against SARS-CoV-2 with a high degree of mutation resistance. name mentioned* literature_supp
35347236 Mouse and human antibodies bind HLA-E-leader peptide complexes and enhance NK cell cytotoxicity. name mentioned* literature_supp
35383174 Efficient human-like antibody repertoire and hybridoma production in trans-chromosomic mice carrying megabase-sized human immunoglobulin loci. name mentioned* literature_supp
35447092 Analysis of memory B cells identifies conserved neutralizing epitopes on the N-terminal domain of variant SARS-Cov-2 spike proteins. name mentioned* literature_supp
35776090 Antibody evolution to SARS-CoV-2 after single-dose Ad26.COV2.S vaccine in humans. name mentioned* literature_supp
36006380 Humoral immunity to SARS-CoV-2 elicited by combination COVID-19 vaccination regimens. name mentioned* literature_supp
36149398 Memory B cell responses to Omicron subvariants after SARS-CoV-2 mRNA breakthrough infection in humans. name mentioned* literature_supp
36328595 Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing. name mentioned* literature_supp
36473496 Antibody feedback regulates immune memory after SARS-CoV-2 mRNA vaccination. name mentioned* literature_supp
36827454 Modeling and predicting the overlap of B- and T-cell receptor repertoires in healthy and SARS-CoV-2 infected individuals. name mentioned* literature_supp
37076511 Vaccination of SARS-CoV-2-infected individuals expands a broad range of clonally diverse affinity-matured B cell lineages. name mentioned* literature_supp
37368240 Memory B cell development elicited by mRNA booster vaccinations in the elderly. name mentioned* literature_supp
38205245 Comprehensive characterization and database construction of immune repertoire in the largest Chinese glioma cohort. name mentioned* literature_supp
38435425 Analysis of immunoglobulin/T-cell receptor repertoires by high-throughput RNA sequencing reveals a continuous dynamic of positive clonal selection in follicular lymphoma. name mentioned* literature_supp
38668227 Identification of an IGHV3-53-Encoded RBD-Targeting Cross-Neutralizing Antibody from an Early COVID-19 Convalescent. name mentioned* literature_supp
38707998 Maintenance of caecal homeostasis by diverse adaptive immune cells in the rhesus macaque. name mentioned* literature_supp
38844673 Resolving haplotype variation and complex genetic architecture in the human immunoglobulin kappa chain locus in individuals of diverse ancestry. name mentioned* literature_supp
40664667 High-resolution mapping of single cells in spatial context. name mentioned* literature_supp
40750588 Structural basis of broad protection against influenza virus by human antibodies targeting the neuraminidase active site via a recurring motif in CDR H3. name mentioned* literature_supp
40789024 Structural insights into VRC01-class bnAb precursors with diverse light chains elicited in the IAVI G001 human vaccine trial. name mentioned* literature_supp
41021799 Molecular divergence and convergence of mammalian antibody responses to the influenza virus hemagglutinin stem. name mentioned* literature_supp
41803327 IFN-gene signatures in B cells following influenza A and B virus infection and influenza vaccination. name mentioned* literature_supp
41941497 Pigs lacking Natural Killer T cells have altered cellular responses to influenza. name mentioned* literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT, MUSA, OGRDB, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

PartSequenceSourceRSS UID
v_rsCACAGTGTTACACACCCGAACATAAACC IMGT MUSA RHESUS-RI4XC5

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)SplitSourceLeader UID
ATGGACATGAGGGTCCCCGCTCAGCTCCTGGGGCTCCTTCTGCTCTGGCTCCCAGGTGCCAGATGT 55 + 11 nt IMGT RHESUS-L5U6XP
ATGGACATGAGGGTCCCCGCTCAGCTCCTGGGGCTCCTTCTGCTCTGGCTCCCAGGTGTGCCAGATGT 57 + 11 nt MUSA RHESUS-L6OURA

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/RHESUS-VQCQON3YR/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

287 nt
GACATCCAGATGACCCAGTCTCCATCTTCCCTGTCTGCATCTGTAGGAGACAGAGTCACCATCACTTGCAGGGCAAGTCAGGGCATTAGCACTTATTTAAATTGGTATCAGCAGAAACCAGGAAAAGCTCCTAAGCGCCTGATCTATGCTGCATCCAGTTTGGAAAGTGGGGTCCCATCAAGGTTCAGTGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAGATTTTGCAACTTATTACTGTCTACAGTATAACAGTGACCCTCC

Amino-acid sequence (V-REGION)

95 aa
DIQMTQSPSSLSASVGDRVTITCRASQGISTYLNWYQQKPGKAPKRLIYAASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQYNSDP

Published by the source, and consistent with the nucleotide sequence above. i