RHESUS-VQQ3AUOZP

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesMacaca mulatta LocusIGK TypeV FunctionalFalse Length305 nt

IGKV4S1*01: a Macaca mulatta IGK V allele sequence, 305 nt, non-functional. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Macaca mulatta (NCBITAXON:9544)
Locus / type	IGK / V
Functional i	False
Length	305 nt
Protein UID i	RHESUS-VP-46M74A (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

305 nt

GACATTGTGATGACCCAGTCTCCAGACTCCCTGGCTGTGTCTCTGGGAGAGAGGGTCACCATCAACTGCAAGTCCAGCCGGAGTCTTTTATACAGCTCCAACAATAAGAACTACTTAGCCTGGTACCAGCAGAAACCAGGACAGGCTCCTAAGCTGCTCGTTTACTGGGCATCTACCCGGGAATCCGGGGTCCCTAACCGATTCAGTGGCAGCGGGTCTGGGACAGATTTCACTCTCACCATCAGTGGCCTGCAGGCTGAAGATGTGGCAGTTTATTACTGTCAGCAGTATTATAGCTCTCCTCT

Amino-acid sequence (V-REGION)

101 aa

DIVMTQSPDSLAVSLGERVTINCKSSRSLLYSSNNKNYLAWYQQKPGQAPKLLVYWASTRESGVPNRFSGSGSGTDFTLTISGLQAEDVAVYYCQQYYSSP

Published by the source, and consistent with the nucleotide sequence above. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (RHESUS-VQQ3AUOZP). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGKV4S1*01	IgLabel	MUSA
IGKV4S1*01	IMGT	IMGT

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

Name	Kind	Source(s)
X79831.1	NCBI accession	ncbi_nucleotide

External records i

NCBI nucleotide: link GenBank: GENBANK:X79831 GenBank: GENBANK:X79831.1 IMGT: IGKV4S1*01

Literature references 1 total · 1 verified i

PubMed publications linked to this allele.

PMID	Title	Evidence	Source
7759095		verified	ncbi_nucleotide

Contributed by IMGT, MUSA, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CACAGTGCTTCAGCCTCGAACACAAACC	IMGT	RHESUS-RV2UXJ

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/RHESUS-VQQ3AUOZP/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases