RHESUS-VRCL6QUKQ

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesMacaca mulatta LocusIGH TypeV FunctionalTrue Length296 nt

IGHV4-80*03: a Macaca mulatta IGH V allele sequence, 296 nt, functional. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Macaca mulatta (NCBITAXON:9544)
Locus / type	IGH / V
Functional i	True
Length	296 nt
Protein UID i	RHESUS-VP-FKTC2H (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

296 nt

CAGGTGCAGCTGCAGGAGTCGGGCCCAGGACTGGTGAAGCCTTCGGAGACCCTGTCCCTCACCTGCGCTGTCTCTGGTGCCCCCATCAGTAGTTACTGGTGGAGCTGGATCCGCCAGCCCCCAGGGAAGGGACTGGAGTGGATTGGGGAGATCAATGGTAATAGTGGTAGCACCTACTACAACCCCTCCCTCAAGAGTCGAGTCACCATTTCAAAAGACGCGTCCAAGAACCAGTTCTCCCTGAAGCTGAGCTCTGTGACCGCCGCGGACACGGCCGTGTATTACTGTGCGAGAGA

Amino-acid sequence (V-REGION)

98 aa

QVQLQESGPGLVKPSETLSLTCAVSGAPISSYWWSWIRQPPGKGLEWIGEINGNSGSTYYNPSLKSRVTISKDASKNQFSLKLSSVTAADTAVYYCAR

Published by the source, and consistent with the nucleotide sequence above. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (RHESUS-VRCL6QUKQ). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGHV4-80*03	IgLabel	MUSA
IGHV4-80*03	IMGT	IMGT

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

Name	Kind	Source(s)
U57580.2	NCBI accession	ncbi_nucleotide

External records i

NCBI nucleotide: link GenBank: GENBANK:U57580 GenBank: GENBANK:U57580.2 IMGT: IGHV4-80*03

Literature references 1 total · 1 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
40977881	IMGT® analysis of the human IGH locus: unveiling novel polymorphisms and copy number variations in 15 genome assemblies from diverse ancestral backgrounds.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT, MUSA, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATGAAACACCTGTGGTTCTTCCTCCTCCTGGTGGCAGCTCCCAGATGGGTCCTGTCC	46 + 11 nt	IMGT	RHESUS-LUVNEF

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/RHESUS-VRCL6QUKQ/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases