AIRBabel immunoglobulin and T-cell receptor allele sequences · leaders · RSSs

← back to search

RHESUS-VV4QVH7KE

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesMacaca mulatta LocusIGL TypeV FunctionalTrue Length297 nt
SpeciesMacaca mulatta (NCBITAXON:9544)
Locus / typeIGL / V
Functional iTrue
Length297 nt
Protein UID iRHESUS-VP-WOB43V (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

Every name below denotes this exact sequence (RHESUS-VV4QVH7KE). None is canonical; they are labels, and the UID is the key.

NameSchemeSource(s)
IGLV2-66YQ*10 IgLabel MUSA
IGLV2-23*03 IMGT IMGT

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

NameKindSource(s)
AM055977.1 NCBI accession ncbi_nucleotide

External records i

NCBI nucleotide: link GenBank: GENBANK:AM055977 GenBank: GENBANK:AM055977.1 IMGT: IGLV2-23*03

Literature references 20 total · 1 verified · 19 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMIDTitleEvidenceSource
16189671 verified ncbi_nucleotide
25338678 Sequencing of the human IG light chain loci from a hydatidiform mole BAC library reveals locus-specific signatures of genetic diversity. name mentioned* literature_supp
27423190 A Single Human Papillomavirus Vaccine Dose Improves B Cell Memory in Previously Infected Subjects. name mentioned* literature_supp
29558968 BALDR: a computational pipeline for paired heavy and light chain immunoglobulin reconstruction in single-cell RNA-seq data. name mentioned* literature_supp
30697215 VH1-69 Utilizing Antibodies Are Capable of Mediating Non-neutralizing Fc-Mediated Effector Functions Against the Transmitted/Founder gp120. name mentioned* literature_supp
31839985 More than one antibody of individual B cells revealed by single-cell immune profiling. name mentioned* literature_supp
33048842 Antimalarial antibody repertoire defined by plasma IG proteomics and single B cell IG sequencing. name mentioned* literature_supp
33485405 Enhancement versus neutralization by SARS-CoV-2 antibodies from a convalescent donor associates with distinct epitopes on the RBD. name mentioned* literature_supp
34126625 Naturally enhanced neutralizing breadth against SARS-CoV-2 one year after infection. name mentioned* literature_supp
34242577 In vitro and in vivo functions of SARS-CoV-2 infection-enhancing and neutralizing antibodies. name mentioned* literature_supp
34587480 Paired heavy- and light-chain signatures contribute to potent SARS-CoV-2 neutralization in public antibody responses. name mentioned* literature_supp
34788600 Immunizations with diverse sarbecovirus receptor-binding domains elicit SARS-CoV-2 neutralizing antibodies against a conserved site of vulnerability. name mentioned* literature_supp
35108220 Ultrapotent neutralizing antibodies against SARS-CoV-2 with a high degree of mutation resistance. name mentioned* literature_supp
35347236 Mouse and human antibodies bind HLA-E-leader peptide complexes and enhance NK cell cytotoxicity. name mentioned* literature_supp
35447092 Analysis of memory B cells identifies conserved neutralizing epitopes on the N-terminal domain of variant SARS-Cov-2 spike proteins. name mentioned* literature_supp
36328595 Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing. name mentioned* literature_supp
36473496 Antibody feedback regulates immune memory after SARS-CoV-2 mRNA vaccination. name mentioned* literature_supp
36827454 Modeling and predicting the overlap of B- and T-cell receptor repertoires in healthy and SARS-CoV-2 infected individuals. name mentioned* literature_supp
38406579 AIRR-C IG Reference Sets: curated sets of immunoglobulin heavy and light chain germline genes. name mentioned* literature_supp
38435425 Analysis of immunoglobulin/T-cell receptor repertoires by high-throughput RNA sequencing reveals a continuous dynamic of positive clonal selection in follicular lymphoma. name mentioned* literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT, MUSA, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)SplitSourceLeader UID
ACCCTCCTCACTCAGGGCACAGGATCCTGGGCT 22 + 11 nt IMGT RHESUS-L455YO

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/RHESUS-VV4QVH7KE/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

297 nt
CAGGCTGCCCCGACTCAGCCTCCCTCTGTGTCTGGGTCTCCTGGACAGTCGGTCACCATCTCCTGCACTGGAACCAGCAGTGACATCGGTGGTTATAACTATGTCTCCTGGTACCAACAGCACCCAGGCAAAGCCCCCAAACTCATGATTTATGATGTCAGTAAGCGGCCCTCAGGGGTCTCTGATCGCTTCTCTGGCTCCAAATCTGGCAACACGGCCTCCCTGACCATCTCTGGGCTCCAGGCTGAGGATGAGGCTGATTATTACTGCAGCTCATATGCAGGCAGCAACACTTTC

Amino-acid sequence (V-REGION)

99 aa
QAAPTQPPSVSGSPGQSVTISCTGTSSDIGGYNYVSWYQQHPGKAPKLMIYDVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGSNTF

Published by the source, and consistent with the nucleotide sequence above. i