RHESUS-VVTKXIXKS

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesMacaca mulatta LocusIGH TypeV FunctionalNone Length296 nt

IGHV3-7*02: a Macaca mulatta IGH V allele sequence, 296 nt, not recorded. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Macaca mulatta (NCBITAXON:9544)
Locus / type	IGH / V
Functional i	None
Length	296 nt
Protein UID i	RHESUS-VP-7EXVQ7 (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

296 nt

TGGCCAGTGTGAGTTGCTGCTGGTGGAGACTTGGTACAGCCCATGGGGGTCCTGAGACTCTCCTGTGCAGCCTCTGGATCCACCTTCAGTAGTTGCTGGATCAGCTGAATAGGCCAGGCTCCAGGGAAGGGGCTGCAGTGAGTAATAGATGTAAAGTACAATGGAAGAAAGACATACTAAGCAGACTCTGGGAAGGGCAGATTCACCGTCTCCAGAGACAACGCCAACAACTCGCTGTATCTGCAAATGAATAGTCTGAGAGCCAGACTTGGCCCTGTATTGTTGTGTGAAAGATG

Amino-acid sequence (V-REGION)

98 aa

WPV*VAAGGDLVQPMGVLRLSCAASGSTFSSCWIS*IGQAPGKGLQ*VIDVKYNGRKTY*ADSGKGRFTVSRDNANNSLYLQMNSLRARLGPVLLCER

Translated here from the nucleotide sequence; no source published a protein for this allele. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (RHESUS-VVTKXIXKS). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGHV3-7*02	IMGT	IMGT

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

Name	Kind	Source(s)
DQ100973.1	NCBI accession	ncbi_nucleotide

External records i

NCBI nucleotide: link IMGT: IGHV3-7*02

Literature references 21 total · 21 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
29180996	Antibody Heavy Chain Variable Domains of Different Germline Gene Origins Diversify through Different Paths.	name mentioned^*	literature_supp
29558968	BALDR: a computational pipeline for paired heavy and light chain immunoglobulin reconstruction in single-cell RNA-seq data.	name mentioned^*	literature_supp
31839985	More than one antibody of individual B cells revealed by single-cell immune profiling.	name mentioned^*	literature_supp
32365177	Polymorphisms in human immunoglobulin heavy chain variable genes and their upstream regions.	name mentioned^*	literature_supp
32636395	IgCaller for reconstructing immunoglobulin gene rearrangements and oncogenic translocations from whole-genome sequencing in lymphoid neoplasms.	name mentioned^*	literature_supp
34242577	In vitro and in vivo functions of SARS-CoV-2 infection-enhancing and neutralizing antibodies.	name mentioned^*	literature_supp
34764956	Novel Allele Detection Tool Benchmark and Application With Antibody Repertoire Sequencing Dataset.	name mentioned^*	literature_supp
34765543	The Hydropathy Index of the HCDR3 Region of the B-Cell Receptor Identifies Two Subgroups of IGHV-Mutated Chronic Lymphocytic Leukemia Patients With Distinct Outcome.	name mentioned^*	literature_supp
34785098	Landscapes and dynamic diversifications of B-cell receptor repertoires in COVID-19 patients.	name mentioned^*	literature_supp
35205028	Next-Generation Sequencing Revealed a Distinct Immunoglobulin Repertoire with Specific Mutation Hotspots in Acute Myeloid Leukemia.	name mentioned^*	literature_supp
35776090	Antibody evolution to SARS-CoV-2 after single-dose Ad26.COV2.S vaccine in humans.	name mentioned^*	literature_supp
35837088	Characterizing Features of Human Circulating B Cells Carrying CLL-Like Stereotyped Immunoglobulin Rearrangements.	name mentioned^*	literature_supp
36006380	Humoral immunity to SARS-CoV-2 elicited by combination COVID-19 vaccination regimens.	name mentioned^*	literature_supp
36149398	Memory B cell responses to Omicron subvariants after SARS-CoV-2 mRNA breakthrough infection in humans.	name mentioned^*	literature_supp
36328595	Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing.	name mentioned^*	literature_supp
36473496	Antibody feedback regulates immune memory after SARS-CoV-2 mRNA vaccination.	name mentioned^*	literature_supp
37368240	Memory B cell development elicited by mRNA booster vaccinations in the elderly.	name mentioned^*	literature_supp
38643233	An ancestral SARS-CoV-2 vaccine induces anti-Omicron variants antibodies by hypermutation.	name mentioned^*	literature_supp
40066131	Characterization of Immunoglobulin Heavy Locus Rearrangements in Molecular Subtypes of Childhood B-Cell Precursor Acute Lymphoblastic Leukemia.	name mentioned^*	literature_supp
41617721	Refined phenotyping of vaccine responses reveals transcriptomic determinants of neutralizing antibody heterogeneity.	name mentioned^*	literature_supp
42078068	B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CCAAGTGATGGGACATCAGTGTGAGCCCAGACACACAAT	IMGT	RHESUS-RTFAT4

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATGGGATTTTGACAGAGCTGGGTTTTCCTTGTTGTTGTTTTTAAAGTTGTTTGCAGG	46 + 11 nt	IMGT	RHESUS-LN2CSX

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/RHESUS-VVTKXIXKS/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases