RHESUS-VY3TYBXKY

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesMacaca mulatta LocusIGK TypeV FunctionalFalse Length287 nt

IGKV1-29*02: a Macaca mulatta IGK V allele sequence, 287 nt, non-functional. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Macaca mulatta (NCBITAXON:9544)
Locus / type	IGK / V
Functional i	False
Length	287 nt
Protein UID i	RHESUS-VP-OELWP6 (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

287 nt

GACATCAAGATGACATAGTCTCCATTCTTCCTGTCTGCATCTGTAGGAAACAGAGTCACTATCACTTTCCAGGCAACTGAGGGCATTAGTAATGATTTACCCTGGTATCAGCAGAAACCAGGGAAATCCCCTAAGCTCTTCCTCTATGATGCAAAAGATTTGCACACTGGGGTCTCATCGAGGTTCGGTGGCAGTGGCTCTGGGACAGATTTCACTCACACCATCAGCAGCCTGGAGCCTGAAGATTTTGCAACTTATTATTCTAAACAGGAGTTCAGTCACTCTCC

Amino-acid sequence (V-REGION)

95 aa

DIKMT*SPFFLSASVGNRVTITFQATEGISNDLPWYQQKPGKSPKLFLYDAKDLHTGVSSRFGGSGSGTDFTHTISSLEPEDFATYYSKQEFSHS

Published by the source, and consistent with the nucleotide sequence above. i

Name history i: formerly IGKV1-16*01 (to 2015-03-19);

Allele names i

Every name below denotes this exact sequence (RHESUS-VY3TYBXKY). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGKV1-29*02	IgLabel	MUSA
IGKV1-29*02	IMGT	IMGT

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

Name	Kind	Source(s)
NW_001099007.1	NCBI accession	ncbi_nucleotide

Former IMGT names i

Former name	Last seen in IMGT release
*IGKV1-1601**	2015-03-19

External records i

NCBI nucleotide: link NCBI Gene: NCBIGENE:701244 GenBank: GENBANK:NW_001099007 IMGT: IGKV1-29*02

Literature references 21 total · 21 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
19563687	Isolation of a human-like antibody fragment (scFv) that neutralizes ricin biological activity.	name mentioned^*	literature_supp
26382731	Isolation of nanomolar scFvs of non-human primate origin, cross-neutralizing botulinum neurotoxins A1 and A2 by targeting their heavy chain.	name mentioned^*	literature_supp
26440796	Development of Human-Like scFv-Fc Neutralizing Botulinum Neurotoxin E.	name mentioned^*	literature_supp
28974033	The European AntibotABE Framework Program and Its Update: Development of Innovative Botulinum Antibodies.	name mentioned^*	literature_supp
29545810	Repertoire Analysis of Antibody CDR-H3 Loops Suggests Affinity Maturation Does Not Typically Result in Rigidification.	name mentioned^*	literature_supp
31839985	More than one antibody of individual B cells revealed by single-cell immune profiling.	name mentioned^*	literature_supp
34126625	Naturally enhanced neutralizing breadth against SARS-CoV-2 one year after infection.	name mentioned^*	literature_supp
34587480	Paired heavy- and light-chain signatures contribute to potent SARS-CoV-2 neutralization in public antibody responses.	name mentioned^*	literature_supp
35347236	Mouse and human antibodies bind HLA-E-leader peptide complexes and enhance NK cell cytotoxicity.	name mentioned^*	literature_supp
35383174	Efficient human-like antibody repertoire and hybridoma production in trans-chromosomic mice carrying megabase-sized human immunoglobulin loci.	name mentioned^*	literature_supp
35447092	Analysis of memory B cells identifies conserved neutralizing epitopes on the N-terminal domain of variant SARS-Cov-2 spike proteins.	name mentioned^*	literature_supp
35776090	Antibody evolution to SARS-CoV-2 after single-dose Ad26.COV2.S vaccine in humans.	name mentioned^*	literature_supp
36006380	Humoral immunity to SARS-CoV-2 elicited by combination COVID-19 vaccination regimens.	name mentioned^*	literature_supp
36149398	Memory B cell responses to Omicron subvariants after SARS-CoV-2 mRNA breakthrough infection in humans.	name mentioned^*	literature_supp
36328595	Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing.	name mentioned^*	literature_supp
36827454	Modeling and predicting the overlap of B- and T-cell receptor repertoires in healthy and SARS-CoV-2 infected individuals.	name mentioned^*	literature_supp
37368240	Memory B cell development elicited by mRNA booster vaccinations in the elderly.	name mentioned^*	literature_supp
37533642	TRAPnSeq allows high-throughput profiling of antigen-specific antibody-secreting cells.	name mentioned^*	literature_supp
38205245	Comprehensive characterization and database construction of immune repertoire in the largest Chinese glioma cohort.	name mentioned^*	literature_supp
38435425	Analysis of immunoglobulin/T-cell receptor repertoires by high-throughput RNA sequencing reveals a continuous dynamic of positive clonal selection in follicular lymphoma.	name mentioned^*	literature_supp
40664667	High-resolution mapping of single cells in spatial context.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT, MUSA, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	TACAGTGTTATAAGCCCGAACATAAATC	IMGT	RHESUS-RK5JP2

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATTAGGGCCCCCGCTCAGCTCCTGGGACTCCTGCTGCTCTGGCTCCTAGGCATCAGATGT	49 + 11 nt	IMGT	RHESUS-L5GUVJ

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/RHESUS-VY3TYBXKY/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases