RHESUS-VY534HZ3L

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesMacaca mulatta LocusIGL TypeV FunctionalTrue Length294 nt

IGLV1S6*01: a Macaca mulatta IGL V allele sequence, 294 nt, functional. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Macaca mulatta (NCBITAXON:9544)
Locus / type	IGL / V
Functional i	True
Length	294 nt
Protein UID i	RHESUS-VP-LSM4T5 (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

294 nt

CAGTCTGTGCTGACGCAGCCGCCCTCAGTGTCTGCGGCCCCAGGGCAGAAGGTCACCATCTCCTGCTCTGGAAGCAGCTCCAACATCGGGAGAAGTTATGTATCCTGGTACCAGCAGGTCCCAGGAACGGCCCCCAAACTCCTCATCTATGACAATAATAAGCGACCCTCAGGGGTTTCTGACCGATTCTCTGGCTCCAAGTCTGGTACCTCAGCCTCCCTGGCCATCACTGGACTCCAGACTGGAGATGAGGCTGATTATTACTGCGGAGCATGGGATAGCAGCCTGAGTGCT

Amino-acid sequence (V-REGION)

98 aa

QSVLTQPPSVSAAPGQKVTISCSGSSSNIGRSYVSWYQQVPGTAPKLLIYDNNKRPSGVSDRFSGSKSGTSASLAITGLQTGDEADYYCGAWDSSLSA

Published by the source, and consistent with the nucleotide sequence above. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (RHESUS-VY534HZ3L). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGLV1S6*01	IMGT	IMGT

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

Name	Kind	Source(s)
AM056015.1	NCBI accession	ncbi_nucleotide

External records i

NCBI nucleotide: link GenBank: GENBANK:AM056015 GenBank: GENBANK:AM056015.1 IMGT: IGLV1S6*01

Literature references 2 total · 1 verified · 1 sequence-in-paper i

PubMed publications linked to this allele. A sequence-in-paper match indicates that this allele's exact sequence was detected in the publication text or supplementary material; it is sequence-level evidence.

PMID	Title	Evidence	Source
16189671		verified	ncbi_nucleotide
38707998	Maintenance of caecal homeostasis by diverse adaptive immune cells in the rhesus macaque.	sequence in paper	literature_supp

Contributed by IMGT, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ACCCTTCTCATTCACTGCACAGGGTCCTGGGCC	22 + 11 nt	IMGT	RHESUS-LX6CCB

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/RHESUS-VY534HZ3L/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases