SALMON-V2VAZURIV

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesSalmo salar LocusIGH TypeV FunctionalNone Length248 nt

IGHV13-20*01: a Salmo salar IGH V allele sequence, 248 nt, not recorded. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Earlier records of this allele i

IMGT has published this allele name over more than one sequence extent. Earlier sequence extents are deferred from default search results but remain resolvable, so a paper that cited one still leads here.

Record	Name	Length	Relation to this record	IMGT releases
SALMON-VINYGQQ2R	*IGHV13-2001**	305 nt	contains this record	2018-09-27–2019-03-01

Species	Salmo salar (NCBITAXON:8030)
Locus / type	IGH / V
Functional i	None
Length	248 nt
Protein UID i	SALMON-VP-KSNAHL (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

248 nt

ATCTCCTGTAAGACCTCTGGTTATACTCTTGCTAGCTATAGTACTAGCTGGATTCAACAGCATGAGGGCAATGGCATGGAGTGGATTGGTTATGGGGTTTGCGGAACTGGCAGTGGACGACCAGCATAATAGACCCACTTAAGAGCAAAATCGGCTACACAGTTGACACTTCCAGTAGCACAGCGTTTCTACAAGGGAAGAACTTTCAGGCTGAAGACACAGCCGTGCATTACTGTGCTCGCAATTCC

Amino-acid sequence (V-REGION)

82 aa

ISCKTSGYTLASYSTSWIQQHEGNGMEWIGYGVCGTGSGRPA**THLRAKSATQLTLPVAQRFYKGRTFRLKTQPCITVLAI

Translated here from the nucleotide sequence; no source published a protein for this allele. i

Name history i: re-cut from IGHV13-20*01 (305 nt);

Allele names i

Every name below denotes this exact sequence (SALMON-V2VAZURIV). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGHV13-20*01	IMGT	IMGT

External records i

IMGT: IGHV13-20*01

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CACAATGATACAAACCATGGCCAGATCTGTACAAACCCA	IMGT	SALMON-RWVSDG

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/SALMON-V2VAZURIV/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases