SALMON-VO26NER3A

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesSalmo salar LocusIGH TypeV FunctionalNone Length258 nt

IGHV1-2*01: a Salmo salar IGH V allele sequence, 258 nt, not recorded. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Salmo salar (NCBITAXON:8030)
Locus / type	IGH / V
Functional i	None
Length	258 nt
Protein UID i	SALMON-VP-IVPMRX (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

258 nt

GGTCAGACACTGACTGAGTCTGGACCAGTAGTTAAAAATACAGAAGAACCACACAAACTGACCTGTACAGACTCTGATTTAGACATGAATAGCTACTGGATGGCTTGGACCAGACAGGCTCCTGGGAAAGGACTGGAGTGGGTTGCAACTATTATCCATGACAGCAGAAGCACTTTCTACCCCCAGTCTGTTCAGGGTCGGTTCACCATATCCAGATGAACAGCTTGAAGAGTCTGCTGTTTATTATTGTGCCAGAGA

Amino-acid sequence (V-REGION)

86 aa

GQTLTESGPVVKNTEEPHKLTCTDSDLDMNSYWMAWTRQAPGKGLEWVATIIHDSRSTFYPQSVQGRFTISR*TA*RVCCLLLCQR

Translated here from the nucleotide sequence; no source published a protein for this allele. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (SALMON-VO26NER3A). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGHV1-2*01	IMGT	IMGT

External records i

IMGT: IGHV1-2*01

Literature references 25 total · 25 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
20875155	Clustering-based identification of clonally-related immunoglobulin gene sequence sets.	name mentioned^*	literature_supp
24600447	Immunoglobulin and T Cell Receptor Genes: IMGT(®) and the Birth and Rise of Immunoinformatics.	name mentioned^*	literature_supp
25521638	Immunoglobulins: 25 years of immunoinformatics and IMGT-ONTOLOGY.	name mentioned^*	literature_supp
27074145	Maximum-Entropy Models of Sequenced Immune Repertoires Predict Antigen-Antibody Affinity.	name mentioned^*	literature_supp
29283291	Structural insights into humanization of anti-tissue factor antibody 10H10.	name mentioned^*	literature_supp
29558968	BALDR: a computational pipeline for paired heavy and light chain immunoglobulin reconstruction in single-cell RNA-seq data.	name mentioned^*	literature_supp
31839985	More than one antibody of individual B cells revealed by single-cell immune profiling.	name mentioned^*	literature_supp
31873728	Benchmarking immunoinformatic tools for the analysis of antibody repertoire sequences.	name mentioned^*	literature_supp
32636395	IgCaller for reconstructing immunoglobulin gene rearrangements and oncogenic translocations from whole-genome sequencing in lymphoid neoplasms.	name mentioned^*	literature_supp
32878258	Immunoglobulins or Antibodies: IMGT® Bridging Genes, Structures and Functions.	name mentioned^*	literature_supp
33717051	Poorly Expressed Alleles of Several Human Immunoglobulin Heavy Chain Variable Genes are Common in the Human Population.	name mentioned^*	literature_supp
35592326	Pandemic, Epidemic, Endemic: B Cell Repertoire Analysis Reveals Unique Anti-Viral Responses to SARS-CoV-2, Ebola and Respiratory Syncytial Virus.	name mentioned^*	literature_supp
36328595	Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing.	name mentioned^*	literature_supp
36604758	Bacteroides-derived isovaleric acid enhances mucosal immunity by facilitating intestinal IgA response in broilers.	name mentioned^*	literature_supp
37640732	Engaging an HIV vaccine target through the acquisition of low B cell affinity.	name mentioned^*	literature_supp
38567069	Diversification of immunoglobulin genes by gene conversion in the domestic chicken (Gallus gallus domesticus).	name mentioned^*	literature_supp
38961347	Systematic characterization of immunoglobulin loci and deep sequencing of the expressed repertoire in the Atlantic cod (Gadus morhua).	name mentioned^*	literature_supp
39840032	An allelic atlas of immunoglobulin heavy chain variable regions reveals antibody binding epitope preference resilient to SARS-CoV-2 mutation escape.	name mentioned^*	literature_supp
40066131	Characterization of Immunoglobulin Heavy Locus Rearrangements in Molecular Subtypes of Childhood B-Cell Precursor Acute Lymphoblastic Leukemia.	name mentioned^*	literature_supp
40664667	High-resolution mapping of single cells in spatial context.	name mentioned^*	literature_supp
41021799	Molecular divergence and convergence of mammalian antibody responses to the influenza virus hemagglutinin stem.	name mentioned^*	literature_supp
41617721	Refined phenotyping of vaccine responses reveals transcriptomic determinants of neutralizing antibody heterogeneity.	name mentioned^*	literature_supp
41941497	Pigs lacking Natural Killer T cells have altered cellular responses to influenza.	name mentioned^*	literature_supp
42041394	IMGT® Nomenclature of Immunoglobulins (IG) or Antibodies and T Cell Receptors (TR): A Common Language for Immunoinformatics and Artificial Intelligence (AI).	name mentioned^*	literature_supp
42078068	B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CACAGTGACACAGGAGACTGCAGCGCTGTACAAAAACT	IMGT	SALMON-RI3WTC

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/SALMON-VO26NER3A/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases