SHEEP-VLGOJ4BQO

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesOvis aries LocusIGL TypeV FunctionalNone Length298 nt

IGLV1-44*01: a Ovis aries IGL V allele sequence, 298 nt, not recorded. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Ovis aries (NCBITAXON:9940)
Locus / type	IGL / V
Functional i	None
Length	298 nt
Protein UID i	SHEEP-VP-7KH4NL (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

298 nt

CAGGCTGTGCTGACTCAGCCGCCCTCCGTGTCCGGGTCCCCGGGCCAGAGGGTCTCCATCACCTGCTCTGGAAGCAGCAGCAACATCGGGGGTGGTAATTATGTGGGCTGGTACCAACAGCTCCCAGGATCAGGCCTCAAAACCATCATCTATGGTACTAGCAGTCGACCCTCGGGGGTCCCGGACCGATTCTCGGCTCCAGGTCTGGCAACACGGCCACCCTGACCATCAGCTCGCTCCAGGCTGAGGACGAGGCCGATTATTACTGTGCAACTGGTGACAGCAGTAGTTATAATGG

Amino-acid sequence (V-REGION)

99 aa

QAVLTQPPSVSGSPGQRVSITCSGSSSNIGGGNYVGWYQQLPGSGLKTIIYGTSSRPSGVPDRFSAPGLATRPP*PSARSRLRTRPIITVQLVTAVVIM

Translated here from the nucleotide sequence; no source published a protein for this allele. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (SHEEP-VLGOJ4BQO). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGLV1-44*01	IMGT	IMGT

External records i

IMGT: IGLV1-44*01

Literature references 35 total · 35 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
25338678	Sequencing of the human IG light chain loci from a hydatidiform mole BAC library reveals locus-specific signatures of genetic diversity.	name mentioned^*	literature_supp
27423190	A Single Human Papillomavirus Vaccine Dose Improves B Cell Memory in Previously Infected Subjects.	name mentioned^*	literature_supp
27619409	A broadly neutralizing anti-influenza antibody reveals ongoing capacity of haemagglutinin-specific memory B cells to evolve.	name mentioned^*	literature_supp
29545810	Repertoire Analysis of Antibody CDR-H3 Loops Suggests Affinity Maturation Does Not Typically Result in Rigidification.	name mentioned^*	literature_supp
29558968	BALDR: a computational pipeline for paired heavy and light chain immunoglobulin reconstruction in single-cell RNA-seq data.	name mentioned^*	literature_supp
30697215	VH1-69 Utilizing Antibodies Are Capable of Mediating Non-neutralizing Fc-Mediated Effector Functions Against the Transmitted/Founder gp120.	name mentioned^*	literature_supp
31816964	Antibody Structure and Function: The Basis for Engineering Therapeutics.	name mentioned^*	literature_supp
31839985	More than one antibody of individual B cells revealed by single-cell immune profiling.	name mentioned^*	literature_supp
33048842	Antimalarial antibody repertoire defined by plasma IG proteomics and single B cell IG sequencing.	name mentioned^*	literature_supp
33180672	Hiding in plain sight: structure and sequence analysis reveals the importance of the antibody DE loop for antibody-antigen binding.	name mentioned^*	literature_supp
33485405	Enhancement versus neutralization by SARS-CoV-2 antibodies from a convalescent donor associates with distinct epitopes on the RBD.	name mentioned^*	literature_supp
33661303	Plasmodium falciparum-specific IgM B cells dominate in children, expand with malaria, and produce functional IgM.	name mentioned^*	literature_supp
34126625	Naturally enhanced neutralizing breadth against SARS-CoV-2 one year after infection.	name mentioned^*	literature_supp
34242577	In vitro and in vivo functions of SARS-CoV-2 infection-enhancing and neutralizing antibodies.	name mentioned^*	literature_supp
34587480	Paired heavy- and light-chain signatures contribute to potent SARS-CoV-2 neutralization in public antibody responses.	name mentioned^*	literature_supp
34741031	Role of mutations and post-translational modifications in systemic AL amyloidosis studied by cryo-EM.	name mentioned^*	literature_supp
34788600	Immunizations with diverse sarbecovirus receptor-binding domains elicit SARS-CoV-2 neutralizing antibodies against a conserved site of vulnerability.	name mentioned^*	literature_supp
35347236	Mouse and human antibodies bind HLA-E-leader peptide complexes and enhance NK cell cytotoxicity.	name mentioned^*	literature_supp
35447092	Analysis of memory B cells identifies conserved neutralizing epitopes on the N-terminal domain of variant SARS-Cov-2 spike proteins.	name mentioned^*	literature_supp
35776090	Antibody evolution to SARS-CoV-2 after single-dose Ad26.COV2.S vaccine in humans.	name mentioned^*	literature_supp
36006380	Humoral immunity to SARS-CoV-2 elicited by combination COVID-19 vaccination regimens.	name mentioned^*	literature_supp
36149398	Memory B cell responses to Omicron subvariants after SARS-CoV-2 mRNA breakthrough infection in humans.	name mentioned^*	literature_supp
36328595	Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing.	name mentioned^*	literature_supp
36366324	Longitudinal Analyses after COVID-19 Recovery or Prolonged Infection Reveal Unique Immunological Signatures after Repeated Vaccinations.	name mentioned^*	literature_supp
36473496	Antibody feedback regulates immune memory after SARS-CoV-2 mRNA vaccination.	name mentioned^*	literature_supp
36827454	Modeling and predicting the overlap of B- and T-cell receptor repertoires in healthy and SARS-CoV-2 infected individuals.	name mentioned^*	literature_supp
37368240	Memory B cell development elicited by mRNA booster vaccinations in the elderly.	name mentioned^*	literature_supp
37533642	TRAPnSeq allows high-throughput profiling of antigen-specific antibody-secreting cells.	name mentioned^*	literature_supp
38205245	Comprehensive characterization and database construction of immune repertoire in the largest Chinese glioma cohort.	name mentioned^*	literature_supp
38435425	Analysis of immunoglobulin/T-cell receptor repertoires by high-throughput RNA sequencing reveals a continuous dynamic of positive clonal selection in follicular lymphoma.	name mentioned^*	literature_supp
40664667	High-resolution mapping of single cells in spatial context.	name mentioned^*	literature_supp
40710355	Pathogenesis of Graves' Disease Determined Using Single-Cell Sequencing with Thyroid Autoantigen Peptide Stimulation in B Cells.	name mentioned^*	literature_supp
41402326	Cryo-EM structure of renal AL amyloid fibrils from a patient with λ1 light chain amyloidosis.	name mentioned^*	literature_supp
41803327	IFN-gene signatures in B cells following influenza A and B virus infection and influenza vaccination.	name mentioned^*	literature_supp
42306064	IGLV3-21R110 and ibrutinib treatment: Results from the double-blind, randomized, placebo-controlled GCLLSG CLL12 trial in early-stage CLL.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CACAGTGCTCCAGGCCAGGGGGGAAGTGAGACAAAAACC	IMGT	SHEEP-RWMUFG

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATGGCCTGGTCCCCTCTGCTCCTCACCCTGGTCGCTCTCTGCACAGGATCCTGGGCC	46 + 11 nt	IMGT	SHEEP-LEFM6I

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/SHEEP-VLGOJ4BQO/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases