AIRBabel immunoglobulin and T-cell receptor allele sequences · leaders · RSSs

← back to search

HUMAN-V3CHBGVBW

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesHomo sapiens LocusIGH TypeV FunctionalTrue Length296 nt
SpeciesHomo sapiens (NCBITAXON:9606)
Locus / typeIGH / V
Functional iTrue
Length296 nt
Protein UID iHUMAN-VP-LYRK4N (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

Every name below denotes this exact sequence (HUMAN-V3CHBGVBW). None is canonical; they are labels, and the UID is the key.

NameSchemeSource(s)
IGHV1-5HTI*10 IgLabel HUSA
IGHV1-69*14 IMGT IMGT, KIARVA, OGRDB

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

NameKindSource(s)
KC713948.1 NCBI accession ncbi_nucleotide

External records i

NCBI nucleotide: link GenBank: GENBANK:KC713948 GenBank: GENBANK:KC713948.1 IMGT: IGHV1-69*14 OGRDB: IGHV1-69*14

Literature references 20 total · 1 verified · 2 sequence-in-paper · 17 name-mentioned* i

PubMed publications linked to this allele. A sequence-in-paper match indicates that this allele's exact sequence was detected in the publication text or supplementary material; it is sequence-level evidence. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMIDTitleEvidenceSource
23541343 verified ncbi_nucleotide
34764956 Novel Allele Detection Tool Benchmark and Application With Antibody Repertoire Sequencing Dataset. sequence in paper literature_supp
38643233 An ancestral SARS-CoV-2 vaccine induces anti-Omicron variants antibodies by hypermutation. sequence in paper literature_supp
29558968 BALDR: a computational pipeline for paired heavy and light chain immunoglobulin reconstruction in single-cell RNA-seq data. name mentioned* literature_supp
31839985 More than one antibody of individual B cells revealed by single-cell immune profiling. name mentioned* literature_supp
32636395 IgCaller for reconstructing immunoglobulin gene rearrangements and oncogenic translocations from whole-genome sequencing in lymphoid neoplasms. name mentioned* literature_supp
33843586 Distinct clonal evolution of B-cells in HIV controllers with neutralizing antibody breadth. name mentioned* literature_supp
34126625 Naturally enhanced neutralizing breadth against SARS-CoV-2 one year after infection. name mentioned* literature_supp
34484220 RAPID: A Rep-Seq Dataset Analysis Platform With an Integrated Antibody Database. name mentioned* literature_supp
35397794 A large-scale systematic survey reveals recurring molecular features of public antibody responses to SARS-CoV-2. name mentioned* literature_supp
35776090 Antibody evolution to SARS-CoV-2 after single-dose Ad26.COV2.S vaccine in humans. name mentioned* literature_supp
36006380 Humoral immunity to SARS-CoV-2 elicited by combination COVID-19 vaccination regimens. name mentioned* literature_supp
36149398 Memory B cell responses to Omicron subvariants after SARS-CoV-2 mRNA breakthrough infection in humans. name mentioned* literature_supp
36328595 Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing. name mentioned* literature_supp
36473496 Antibody feedback regulates immune memory after SARS-CoV-2 mRNA vaccination. name mentioned* literature_supp
36827454 Modeling and predicting the overlap of B- and T-cell receptor repertoires in healthy and SARS-CoV-2 infected individuals. name mentioned* literature_supp
38435425 Analysis of immunoglobulin/T-cell receptor repertoires by high-throughput RNA sequencing reveals a continuous dynamic of positive clonal selection in follicular lymphoma. name mentioned* literature_supp
39627383 Novel polymorphic and copy number diversity in the antibody IGH locus of South African individuals. name mentioned* literature_supp
41617721 Refined phenotyping of vaccine responses reveals transcriptomic determinants of neutralizing antibody heterogeneity. name mentioned* literature_supp
42078068 B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies. name mentioned* literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by HUSA, IMGT, KIARVA, OGRDB, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

PartSequenceSourceRSS UID
v_rsCACAGTGTGAAAACCCACATCCTGAGAGTGTCAGAAACC HUSA IMGT HUMAN-RNTBEN

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)SplitSourceLeader UID
ATGGACTGGACCTGGAGGTTCCTCTTTGTGGTGGCAGCAGCTACAGGTGTCCAGTCC 46 + 11 nt HUSA IMGT HUMAN-LDPFNZ

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/HUMAN-V3CHBGVBW/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

296 nt
CAGGTCCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGTCCTCGGTGAAGGTCTCCTGCAAGGCTTCTGGAGGCACCTTCAGCAGCTATGCTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAGGGATCATCCCTATCTTTGGTACAGCAAACTACGCACAGAAGTTCCAGGGCAGAGTCACGATTACCGCGGACAAATCCACGAGCACAGCCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTATTACTGTGCGAGAGA

Amino-acid sequence (V-REGION)

98 aa
QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVYYCAR

Published by the source, and consistent with the nucleotide sequence above. i