AIRBabel immunoglobulin and T-cell receptor allele sequences · leaders · RSSs

← back to search

HUMAN-V3VFNK4GI

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesHomo sapiens LocusIGH TypeV FunctionalFalse Length296 nt

Earlier records of this allele i

IMGT has published this allele name over more than one sequence extent. Earlier sequence extents are deferred from default search results but remain resolvable, so a paper that cited one still leads here.

RecordNameLengthRelation to this recordIMGT releases
HUMAN-V3JQ5JHZL IGHV3-25*03 294 nt contained in this record 2013-01-20–2020-01-31
SpeciesHomo sapiens (NCBITAXON:9606)
Locus / typeIGH / V
Functional iFalse
Length296 nt
Protein UID iHUMAN-VP-VFECCW (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

Every name below denotes this exact sequence (HUMAN-V3VFNK4GI). None is canonical; they are labels, and the UID is the key.

NameSchemeSource(s)
IGHV3-2WFU*02 IgLabel HUSA
IGHV3-25*03 IMGT IMGT, OGRDB

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

NameKindSource(s)
AC245166.2 NCBI accession ncbi_nucleotide

External records i

NCBI nucleotide: link GenBank: GENBANK:AC245166 GenBank: GENBANK:AC245166.2 IMGT: IGHV3-25*03 OGRDB: IGHV3-25*03

Literature references 5 total · 5 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMIDTitleEvidenceSource
34484220 RAPID: A Rep-Seq Dataset Analysis Platform With an Integrated Antibody Database. name mentioned* literature_supp
34764956 Novel Allele Detection Tool Benchmark and Application With Antibody Repertoire Sequencing Dataset. name mentioned* literature_supp
36328595 Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing. name mentioned* literature_supp
41617721 Refined phenotyping of vaccine responses reveals transcriptomic determinants of neutralizing antibody heterogeneity. name mentioned* literature_supp
42078068 B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies. name mentioned* literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by HUSA, IMGT, OGRDB, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

PartSequenceSourceRSS UID
v_rsCACAGTGAGGGGAGGTCAGTGTGAGCCCAGACACAAACC IMGT HUMAN-R6AAZB

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)SplitSourceLeader UID
ATGGAGTTTGTGCTGAGCTGGGTTTTCCTTGTTGCTATTTTAAAACGTATCCAGTGT 46 + 11 nt IMGT HUMAN-LXNSY2

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/HUMAN-V3VFNK4GI/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

296 nt
GAGATGCAGCTGGTGGAGTCTGGGGGAGGCTTGGCAAAGCCTGCGTGGTCCCCGAGACTCTCCTGTGCAGCCTCTCAATTCACCTTCAGTAGCTACTACATGAACTGTGTCCGCCAGGCTCCAGGGAATGGGCTGGAGTTGGTTGGACAAGTTAATCCTAATGGGGGTAGCACATACCTCATAGACTCCGGTAAGGACCGATTCAATACCTCCAGAGATAACGCCAAGAACACACTTCATCTGCAAATGAACAGCCTGAAAACCGAGGACACGGCCCTGTATTAGTGTACCAGAGA

Amino-acid sequence (V-REGION)

98 aa
EMQLVESGGGLAKPAWSPRLSCAASQFTFSSYYMNCVRQAPGNGLELVGQVNPNGGSTYLIDSGKDRFNTSRDNAKNTLHLQMNSLKTEDTALY*CTR

Published by the source, and consistent with the nucleotide sequence above. i