HUMAN-VA6XADXV3

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesHomo sapiens LocusIGH TypeV FunctionalTrue Length296 nt

IGHV4-28*07: a Homo sapiens IGH V allele sequence, 296 nt, functional. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Homo sapiens (NCBITAXON:9606)
Locus / type	IGH / V
Functional i	True
Length	296 nt
Protein UID i	HUMAN-VP-W3UAJZ (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

296 nt

CAGGTACAGCTGCAGGAGTCGGGCCCAGGACTGGTGAAGCCTTCGGACACCCTGTCCCTCACCTGCGCTGTCTCTGGTTACTCCATCAGCAGTAGTAACTGGTGGGGCTGGATCCGGCAGCCCCCAGGGAAGGGACTGGAGTGGATTGGGTACATCTATTATAGTGGGAGCACCTACTACAACCCGTCCCTCAAGAGTCGAGTCACCATGTCAGTAGACACGTCCAAGAACCAGTTCTCCCTGAAGCTGAGCTCTGTGACCGCCGTGGACACGGCCGTGTATTACTGTGCGAGAAA

Amino-acid sequence (V-REGION)

98 aa

QVQLQESGPGLVKPSDTLSLTCAVSGYSISSSNWWGWIRQPPGKGLEWIGYIYYSGSTYYNPSLKSRVTMSVDTSKNQFSLKLSSVTAVDTAVYYCAR

Published by the source, and consistent with the nucleotide sequence above. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (HUMAN-VA6XADXV3). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGHV4-28*07	IMGT	IMGT, KIARVA, OGRDB

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

Name	Kind	Source(s)
KC713936.1	NCBI accession	ncbi_nucleotide

External records i

NCBI nucleotide: link GenBank: GENBANK:KC713936 GenBank: GENBANK:KC713936.1 IMGT: IGHV4-28*07 OGRDB: IGHV4-28*07

Literature references 9 total · 1 verified · 2 sequence-in-paper · 6 name-mentioned* i

PubMed publications linked to this allele. A sequence-in-paper match indicates that this allele's exact sequence was detected in the publication text or supplementary material; it is sequence-level evidence. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
23541343		verified	ncbi_nucleotide
34764956	Novel Allele Detection Tool Benchmark and Application With Antibody Repertoire Sequencing Dataset.	sequence in paper	literature_supp
38643233	An ancestral SARS-CoV-2 vaccine induces anti-Omicron variants antibodies by hypermutation.	sequence in paper	literature_supp
31839985	More than one antibody of individual B cells revealed by single-cell immune profiling.	name mentioned^*	literature_supp
34484220	RAPID: A Rep-Seq Dataset Analysis Platform With an Integrated Antibody Database.	name mentioned^*	literature_supp
37114042	Adaptive immune receptor genotyping using the corecount program.	name mentioned^*	literature_supp
38435425	Analysis of immunoglobulin/T-cell receptor repertoires by high-throughput RNA sequencing reveals a continuous dynamic of positive clonal selection in follicular lymphoma.	name mentioned^*	literature_supp
39627383	Novel polymorphic and copy number diversity in the antibody IGH locus of South African individuals.	name mentioned^*	literature_supp
42078068	B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT, KIARVA, OGRDB, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CACAGTGAGGGGAGGTGAGTGTGAGCCCAGACACAAACC	IMGT	HUMAN-RXT2LD

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATGAAACACCTGTGGTTCTTCCTCCTGCTGGTGGCAGCTCCCAGATGGGTCCTGTCC	46 + 11 nt	IMGT	HUMAN-L4QT74

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/HUMAN-VA6XADXV3/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases