AIRBabel immunoglobulin and T-cell receptor allele sequences · leaders · RSSs

← back to search

HUMAN-VGCTDGD2I

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesHomo sapiens LocusIGH TypeV FunctionalTrue Length296 nt

Earlier records of this allele i

IMGT has published this allele name over more than one sequence extent. Earlier sequence extents are deferred from default search results but remain resolvable, so a paper that cited one still leads here.

RecordNameLengthRelation to this recordIMGT releases
HUMAN-VBZPW2LGY IGHV3-30-3*01 294 nt contained in this record 2013-01-20–2015-03-19
SpeciesHomo sapiens (NCBITAXON:9606)
Locus / typeIGH / V
Functional iTrue
Length296 nt
Protein UID iHUMAN-VP-56AGDW (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

Every name below denotes this exact sequence (HUMAN-VGCTDGD2I). None is canonical; they are labels, and the UID is the key.

Multiple allele designations. This one sequence is recorded under 2 different allele designations: IGHV3-30-3*01, IGHV3-30-7*01. These are identical normalized nucleotide sequences with different attributed names.

NameSchemeSource(s)
IGHV3-4JW6*03 IgLabel HUSA
IGHV3-30-3*01 IMGT IMGT, KIARVA, OGRDB
IGHV3-30-7*01 IMGT IMGT

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

NameKindSource(s)
AC244456.2 NCBI accession ncbi_nucleotide

External records i

NCBI nucleotide: link GenBank: GENBANK:AC244456 GenBank: GENBANK:IMGT000315 IMGT: IGHV3-30-3*01 OGRDB: IGHV3-30-3*01

Literature references 55 total · 5 sequence-in-paper · 50 name-mentioned* i

PubMed publications linked to this allele. A sequence-in-paper match indicates that this allele's exact sequence was detected in the publication text or supplementary material; it is sequence-level evidence. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMIDTitleEvidenceSource
34764956 Novel Allele Detection Tool Benchmark and Application With Antibody Repertoire Sequencing Dataset. sequence in paper literature_supp
36353774 High activation levels maintained in receptor-binding domain-specific memory B cells in people with severe coronavirus disease 2019. sequence in paper literature_supp
37076511 Vaccination of SARS-CoV-2-infected individuals expands a broad range of clonally diverse affinity-matured B cell lineages. sequence in paper literature_supp
37114042 Adaptive immune receptor genotyping using the corecount program. sequence in paper literature_supp
38643233 An ancestral SARS-CoV-2 vaccine induces anti-Omicron variants antibodies by hypermutation. sequence in paper literature_supp
22216179 Biased use of the IGHV4 family and evidence for antigen selection in Chlamydophila psittaci-negative ocular adnexal extranodal marginal zone lymphomas. name mentioned* literature_supp
25330199 Characteristics of memory B cells elicited by a highly efficacious HPV vaccine in subjects with no pre-existing immunity. name mentioned* literature_supp
29545810 Repertoire Analysis of Antibody CDR-H3 Loops Suggests Affinity Maturation Does Not Typically Result in Rigidification. name mentioned* literature_supp
29558968 BALDR: a computational pipeline for paired heavy and light chain immunoglobulin reconstruction in single-cell RNA-seq data. name mentioned* literature_supp
29662487 Acquisition of N-Glycosylation Sites in Immunoglobulin Heavy Chain Genes During Local Expansion in Parotid Salivary Glands of Primary Sjögren Patients. name mentioned* literature_supp
30530648 Virus-inclusive single-cell RNA sequencing reveals the molecular signature of progression to severe dengue. name mentioned* literature_supp
31839985 More than one antibody of individual B cells revealed by single-cell immune profiling. name mentioned* literature_supp
31974198 Genomic arrays identify high-risk chronic lymphocytic leukemia with genomic complexity: a multi-center study. name mentioned* literature_supp
32425948 AID Overlapping and Polη Hotspots Are Key Features of Evolutionary Variation Within the Human Antibody Heavy Chain (IGHV) Genes. name mentioned* literature_supp
32636395 IgCaller for reconstructing immunoglobulin gene rearrangements and oncogenic translocations from whole-genome sequencing in lymphoid neoplasms. name mentioned* literature_supp
32668194 Next-Generation Sequencing of T and B Cell Receptor Repertoires from COVID-19 Patients Showed Signatures Associated with Severity of Disease. name mentioned* literature_supp
33485405 Enhancement versus neutralization by SARS-CoV-2 antibodies from a convalescent donor associates with distinct epitopes on the RBD. name mentioned* literature_supp
33843586 Distinct clonal evolution of B-cells in HIV controllers with neutralizing antibody breadth. name mentioned* literature_supp
33969321 Divergent and self-reactive immune responses in the CNS of COVID-19 patients with neurological symptoms. name mentioned* literature_supp
34126625 Naturally enhanced neutralizing breadth against SARS-CoV-2 one year after infection. name mentioned* literature_supp
34242577 In vitro and in vivo functions of SARS-CoV-2 infection-enhancing and neutralizing antibodies. name mentioned* literature_supp
34484220 RAPID: A Rep-Seq Dataset Analysis Platform With an Integrated Antibody Database. name mentioned* literature_supp
34614412 mRNA vaccination of naive and COVID-19-recovered individuals elicits potent memory B cells that recognize SARS-CoV-2 variants. name mentioned* literature_supp
34671351 Computational Inference, Validation, and Analysis of 5'UTR-Leader Sequences of Alleles of Immunoglobulin Heavy Chain Variable Genes. name mentioned* literature_supp
34765543 The Hydropathy Index of the HCDR3 Region of the B-Cell Receptor Identifies Two Subgroups of IGHV-Mutated Chronic Lymphocytic Leukemia Patients With Distinct Outcome. name mentioned* literature_supp
34785098 Landscapes and dynamic diversifications of B-cell receptor repertoires in COVID-19 patients. name mentioned* literature_supp
34788600 Immunizations with diverse sarbecovirus receptor-binding domains elicit SARS-CoV-2 neutralizing antibodies against a conserved site of vulnerability. name mentioned* literature_supp
35108220 Ultrapotent neutralizing antibodies against SARS-CoV-2 with a high degree of mutation resistance. name mentioned* literature_supp
35347236 Mouse and human antibodies bind HLA-E-leader peptide complexes and enhance NK cell cytotoxicity. name mentioned* literature_supp
35397794 A large-scale systematic survey reveals recurring molecular features of public antibody responses to SARS-CoV-2. name mentioned* literature_supp
35447092 Analysis of memory B cells identifies conserved neutralizing epitopes on the N-terminal domain of variant SARS-Cov-2 spike proteins. name mentioned* literature_supp
35776090 Antibody evolution to SARS-CoV-2 after single-dose Ad26.COV2.S vaccine in humans. name mentioned* literature_supp
35837088 Characterizing Features of Human Circulating B Cells Carrying CLL-Like Stereotyped Immunoglobulin Rearrangements. name mentioned* literature_supp
36006380 Humoral immunity to SARS-CoV-2 elicited by combination COVID-19 vaccination regimens. name mentioned* literature_supp
36149398 Memory B cell responses to Omicron subvariants after SARS-CoV-2 mRNA breakthrough infection in humans. name mentioned* literature_supp
36341420 Rheumatoid factor IgM autoantibodies control IgG homeostasis. name mentioned* literature_supp
36473496 Antibody feedback regulates immune memory after SARS-CoV-2 mRNA vaccination. name mentioned* literature_supp
36574772 Immunoglobulin germline gene polymorphisms influence the function of SARS-CoV-2 neutralizing antibodies. name mentioned* literature_supp
36798124 Analysis of IGH allele content in a sample group of rheumatoid arthritis patients demonstrates unrevealed population heterogeneity. name mentioned* literature_supp
36827454 Modeling and predicting the overlap of B- and T-cell receptor repertoires in healthy and SARS-CoV-2 infected individuals. name mentioned* literature_supp
36874132 Characterization of clonal immunoglobulin heavy V-D-J gene rearrangements in Chinese patients with chronic lymphocytic leukemia: Clinical features and molecular profiles. name mentioned* literature_supp
37041983 Frequent use of IGHV3-30-3 in SARS-CoV-2 neutralizing antibody responses. name mentioned* literature_supp
37368240 Memory B cell development elicited by mRNA booster vaccinations in the elderly. name mentioned* literature_supp
38435425 Analysis of immunoglobulin/T-cell receptor repertoires by high-throughput RNA sequencing reveals a continuous dynamic of positive clonal selection in follicular lymphoma. name mentioned* literature_supp
39627383 Novel polymorphic and copy number diversity in the antibody IGH locus of South African individuals. name mentioned* literature_supp
40066131 Characterization of Immunoglobulin Heavy Locus Rearrangements in Molecular Subtypes of Childhood B-Cell Precursor Acute Lymphoblastic Leukemia. name mentioned* literature_supp
40433552 Antigen selection reflected in the subclonal architecture of the B-cell receptor immunoglobulin gene repertoire in splenic marginal zone lymphoma. name mentioned* literature_supp
40588565 Disease-specific U1 spliceosomal RNA mutations in mature B-cell neoplasms. name mentioned* literature_supp
40664667 High-resolution mapping of single cells in spatial context. name mentioned* literature_supp
41617721 Refined phenotyping of vaccine responses reveals transcriptomic determinants of neutralizing antibody heterogeneity. name mentioned* literature_supp
41803327 IFN-gene signatures in B cells following influenza A and B virus infection and influenza vaccination. name mentioned* literature_supp
41908503 Acute Acalculous Cholecystitis Mimicry: Symptomatic Hepatic Infiltration From Chronic Lymphocytic Leukemia Presenting as Cholestatic Liver Injury. name mentioned* literature_supp
42078068 B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies. name mentioned* literature_supp
42256548 Genomic heterogeneity in primary cutaneous follicular center lymphomas reveals different clinicopathological subgroups. name mentioned* literature_supp
42306064 IGLV3-21R110 and ibrutinib treatment: Results from the double-blind, randomized, placebo-controlled GCLLSG CLL12 trial in early-stage CLL. name mentioned* literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by HUSA, IMGT, KIARVA, OGRDB, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

PartSequenceSourceRSS UID
v_rsCACAGTGAGGGGAGGCCATTGTGCGCCCAGACACAAACC HUSA HUMAN-R2EP6Z
v_rsCACAGTGAGGGGAGGTCATTGTGCGCCCAGACACAAACC HUSA HUMAN-RB357F
v_rsCACAGTGAGGGGAAGTCATTGTGCGCCCAGACACAAACC HUSA IMGT HUMAN-RKMQBO

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)SplitSourceLeader UID
ATGGAGTTTGGGCTGAGGTGGGTTTTCCTCGTTGCTCTTTTAAGAGGTGTCCAGTGT 46 + 11 nt HUSA HUMAN-LDACSA
ATGGAGTTTGGGCTGAGCTGGGTTTTCCTCGTTGCTCTTTTAAGAGGTGTCCAGTGT 46 + 11 nt HUSA IMGT HUMAN-LGAUJJ

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/HUMAN-VGCTDGD2I/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

296 nt
CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTCAGTAGCTATGCTATGCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGGCAGTTATATCATATGATGGAAGCAATAAATACTACGCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGAGAGCTGAGGACACGGCTGTGTATTACTGTGCGAGAGA

Amino-acid sequence (V-REGION)

98 aa
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR

Published by the source, and consistent with the nucleotide sequence above. i