HUMAN-VQEWNVRBT

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesHomo sapiens LocusIGH TypeV FunctionalTrue Length296 nt

Species	Homo sapiens (NCBITAXON:9606)
Locus / type	IGH / V
Functional i	True
Length	296 nt
Protein UID i	HUMAN-VP-56CYT5 (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

Every name below denotes this exact sequence (HUMAN-VQEWNVRBT). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGHV3-21*02	IMGT	IMGT

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

Name	Kind	Source(s)
M99658.1	NCBI accession	ncbi_nucleotide

External records i

NCBI nucleotide: link GenBank: GENBANK:M99658 GenBank: GENBANK:M99658.1 IMGT: IGHV3-21*02

Literature references 26 total · 1 verified · 3 sequence-in-paper · 22 name-mentioned* i

PubMed publications linked to this allele. A sequence-in-paper match indicates that this allele's exact sequence was detected in the publication text or supplementary material; it is sequence-level evidence. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
8490662		verified	ncbi_nucleotide
34764956	Novel Allele Detection Tool Benchmark and Application With Antibody Repertoire Sequencing Dataset.	sequence in paper	literature_supp
36353774	High activation levels maintained in receptor-binding domain-specific memory B cells in people with severe coronavirus disease 2019.	sequence in paper	literature_supp
38643233	An ancestral SARS-CoV-2 vaccine induces anti-Omicron variants antibodies by hypermutation.	sequence in paper	literature_supp
25330199	Characteristics of memory B cells elicited by a highly efficacious HPV vaccine in subjects with no pre-existing immunity.	name mentioned^*	literature_supp
25799103	VDJSeq-Solver: in silico V(D)J recombination detection tool.	name mentioned^*	literature_supp
29558968	BALDR: a computational pipeline for paired heavy and light chain immunoglobulin reconstruction in single-cell RNA-seq data.	name mentioned^*	literature_supp
31839985	More than one antibody of individual B cells revealed by single-cell immune profiling.	name mentioned^*	literature_supp
32636395	IgCaller for reconstructing immunoglobulin gene rearrangements and oncogenic translocations from whole-genome sequencing in lymphoid neoplasms.	name mentioned^*	literature_supp
32668194	Next-Generation Sequencing of T and B Cell Receptor Repertoires from COVID-19 Patients Showed Signatures Associated with Severity of Disease.	name mentioned^*	literature_supp
33485405	Enhancement versus neutralization by SARS-CoV-2 antibodies from a convalescent donor associates with distinct epitopes on the RBD.	name mentioned^*	literature_supp
33843586	Distinct clonal evolution of B-cells in HIV controllers with neutralizing antibody breadth.	name mentioned^*	literature_supp
34484220	RAPID: A Rep-Seq Dataset Analysis Platform With an Integrated Antibody Database.	name mentioned^*	literature_supp
34785098	Landscapes and dynamic diversifications of B-cell receptor repertoires in COVID-19 patients.	name mentioned^*	literature_supp
35397794	A large-scale systematic survey reveals recurring molecular features of public antibody responses to SARS-CoV-2.	name mentioned^*	literature_supp
35837088	Characterizing Features of Human Circulating B Cells Carrying CLL-Like Stereotyped Immunoglobulin Rearrangements.	name mentioned^*	literature_supp
36328595	Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing.	name mentioned^*	literature_supp
36351924	Single-cell profiling reveals a memory B cell-like subtype of follicular lymphoma with increased transformation risk.	name mentioned^*	literature_supp
36827454	Modeling and predicting the overlap of B- and T-cell receptor repertoires in healthy and SARS-CoV-2 infected individuals.	name mentioned^*	literature_supp
37533642	TRAPnSeq allows high-throughput profiling of antigen-specific antibody-secreting cells.	name mentioned^*	literature_supp
38435425	Analysis of immunoglobulin/T-cell receptor repertoires by high-throughput RNA sequencing reveals a continuous dynamic of positive clonal selection in follicular lymphoma.	name mentioned^*	literature_supp
40588565	Disease-specific U1 spliceosomal RNA mutations in mature B-cell neoplasms.	name mentioned^*	literature_supp
41617721	Refined phenotyping of vaccine responses reveals transcriptomic determinants of neutralizing antibody heterogeneity.	name mentioned^*	literature_supp
41803327	IFN-gene signatures in B cells following influenza A and B virus infection and influenza vaccination.	name mentioned^*	literature_supp
42078068	B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies.	name mentioned^*	literature_supp
42306064	IGLV3-21R110 and ibrutinib treatment: Results from the double-blind, randomized, placebo-controlled GCLLSG CLL12 trial in early-stage CLL.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CACAGTGAGGGGAAGTCAGTGTGAGCCCAGACACAAACC	IMGT	HUMAN-REXGWW

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATGGAACTGGGGCTCCGCTGGGTTTTCCTTGTTGCTATTTTAGAAGGTGTCCAGTGT	46 + 11 nt	IMGT	HUMAN-LFBR77

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/HUMAN-VQEWNVRBT/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

296 nt

GAGGTGCAACTGGTGGAGTCTGGGGGAGGCCTGGTCAAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTCAGTAGCTATAGCATGAACTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCTCATCCATTAGTAGTAGTAGTAGTTACATATACTACGCAGACTCAGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACTCACTGTATCTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCTGTGTATTACTGTGCGAGAGA

Amino-acid sequence (V-REGION)

98 aa

EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR

Published by the source, and consistent with the nucleotide sequence above. i

API: JSON · AIRR AlleleDescription · aliases