AIRBabel immunoglobulin and T-cell receptor allele sequences · leaders · RSSs

← back to search

HUMAN-VSGQ3LUMY

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

StatusArchived · seen 2013-01-20 → 2022-01-17 SpeciesHomo sapiens LocusIGH TypeV FunctionalNone Length291 nt RecordSuperseded

A newer source record exists for this allele designation. IGHV3-66*02 is still published by IMGT as HUMAN-VR4KXPMTP, 293 nt, which contains this sequence. This is the earlier record (291 nt, current in IMGT releases 2013-01-20–2022-01-17). The allele was not renamed and it was not withdrawn: IMGT changed the published sequence extent associated with this designation. Both extents are kept because a sequence is identified by its bases, so a change in extent is a different sequence.

SpeciesHomo sapiens (NCBITAXON:9606)
Locus / typeIGH / V
Functional iNone
Length291 nt
Protein UID iHUMAN-VP-HV3DDE (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

None.

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

NameKindSource(s)
PQ478845.1 NCBI accession ncbi_nucleotide

Former IMGT names i

Former nameLast seen in IMGT release
IGHV3-66*022013-01-20

External records i

NCBI nucleotide: link GenBank: GENBANK:PQ478845.1

Contributed by IMGT, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/HUMAN-VSGQ3LUMY/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

291 nt
GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTCCAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCGTCAGTAGCAACTACATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCTCAGTTATTTATAGCGGTGGTAGCACATACTACGCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTTCAAATGAACAGCCTGAGAGCTGAGGACACGGCTGTGTATTACTGTGCGAGA

Amino-acid sequence (V-REGION)

97 aa
EVQLVESGGGLVQPGGSLRLSCAASGFTVSSNYMSWVRQAPGKGLEWVSVIYSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR

Translated here from the nucleotide sequence; no source published a protein for this allele. i