AIRBabel immunoglobulin and T-cell receptor allele sequences · leaders · RSSs

← back to search

HUMAN-VR4KXPMTP

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesHomo sapiens LocusIGH TypeV FunctionalTrue Length293 nt

Earlier records of this allele i

IMGT has published this allele name over more than one sequence extent. Earlier sequence extents are deferred from default search results but remain resolvable, so a paper that cited one still leads here.

RecordNameLengthRelation to this recordIMGT releases
HUMAN-VSGQ3LUMY IGHV3-66*02 291 nt contained in this record 2013-01-20–2022-01-17
SpeciesHomo sapiens (NCBITAXON:9606)
Locus / typeIGH / V
Functional iTrue
Length293 nt
Protein UID iHUMAN-VP-HV3DDE (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

Every name below denotes this exact sequence (HUMAN-VR4KXPMTP). None is canonical; they are labels, and the UID is the key.

NameSchemeSource(s)
IGHV3-CVJX*09 IgLabel HUSA
IGHV3-66*02 IMGT IMGT, KIARVA, OGRDB

External records i

GenBank: GENBANK:IMGT000158 IMGT: IGHV3-66*02 OGRDB: IGHV3-66*02

Literature references 38 total · 2 sequence-in-paper · 36 name-mentioned* i

PubMed publications linked to this allele. A sequence-in-paper match indicates that this allele's exact sequence was detected in the publication text or supplementary material; it is sequence-level evidence. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMIDTitleEvidenceSource
37114042 Adaptive immune receptor genotyping using the corecount program. sequence in paper literature_supp
38643233 An ancestral SARS-CoV-2 vaccine induces anti-Omicron variants antibodies by hypermutation. sequence in paper literature_supp
22111995 Isolation of a nanomolar scFv inhibiting the endopeptidase activity of botulinum toxin A, by single-round panning of an immune phage-displayed library of macaque origin. name mentioned* literature_supp
22216179 Biased use of the IGHV4 family and evidence for antigen selection in Chlamydophila psittaci-negative ocular adnexal extranodal marginal zone lymphomas. name mentioned* literature_supp
22806814 Degenerate primer design to clone the human repertoire of immunoglobulin heavy chain variable regions. name mentioned* literature_supp
25330199 Characteristics of memory B cells elicited by a highly efficacious HPV vaccine in subjects with no pre-existing immunity. name mentioned* literature_supp
26440796 Development of Human-Like scFv-Fc Neutralizing Botulinum Neurotoxin E. name mentioned* literature_supp
30697215 VH1-69 Utilizing Antibodies Are Capable of Mediating Non-neutralizing Fc-Mediated Effector Functions Against the Transmitted/Founder gp120. name mentioned* literature_supp
31839985 More than one antibody of individual B cells revealed by single-cell immune profiling. name mentioned* literature_supp
32878258 Immunoglobulins or Antibodies: IMGT® Bridging Genes, Structures and Functions. name mentioned* literature_supp
33661303 Plasmodium falciparum-specific IgM B cells dominate in children, expand with malaria, and produce functional IgM. name mentioned* literature_supp
33843586 Distinct clonal evolution of B-cells in HIV controllers with neutralizing antibody breadth. name mentioned* literature_supp
34120151 Population matched (pm) germline allelic variants of immunoglobulin (IG) loci: Relevance in infectious diseases and vaccination studies in human populations. name mentioned* literature_supp
34126625 Naturally enhanced neutralizing breadth against SARS-CoV-2 one year after infection. name mentioned* literature_supp
34242577 In vitro and in vivo functions of SARS-CoV-2 infection-enhancing and neutralizing antibodies. name mentioned* literature_supp
34484220 RAPID: A Rep-Seq Dataset Analysis Platform With an Integrated Antibody Database. name mentioned* literature_supp
34587480 Paired heavy- and light-chain signatures contribute to potent SARS-CoV-2 neutralization in public antibody responses. name mentioned* literature_supp
34614412 mRNA vaccination of naive and COVID-19-recovered individuals elicits potent memory B cells that recognize SARS-CoV-2 variants. name mentioned* literature_supp
34764956 Novel Allele Detection Tool Benchmark and Application With Antibody Repertoire Sequencing Dataset. name mentioned* literature_supp
34785098 Landscapes and dynamic diversifications of B-cell receptor repertoires in COVID-19 patients. name mentioned* literature_supp
34788600 Immunizations with diverse sarbecovirus receptor-binding domains elicit SARS-CoV-2 neutralizing antibodies against a conserved site of vulnerability. name mentioned* literature_supp
34806017 CRIS: complete reconstruction of immunoglobulin V-D-J sequences from RNA-seq data. name mentioned* literature_supp
35397794 A large-scale systematic survey reveals recurring molecular features of public antibody responses to SARS-CoV-2. name mentioned* literature_supp
35447092 Analysis of memory B cells identifies conserved neutralizing epitopes on the N-terminal domain of variant SARS-Cov-2 spike proteins. name mentioned* literature_supp
35545447 Gene prediction in the immunoglobulin loci. name mentioned* literature_supp
35837088 Characterizing Features of Human Circulating B Cells Carrying CLL-Like Stereotyped Immunoglobulin Rearrangements. name mentioned* literature_supp
36006380 Humoral immunity to SARS-CoV-2 elicited by combination COVID-19 vaccination regimens. name mentioned* literature_supp
36328595 Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing. name mentioned* literature_supp
36353774 High activation levels maintained in receptor-binding domain-specific memory B cells in people with severe coronavirus disease 2019. name mentioned* literature_supp
36473496 Antibody feedback regulates immune memory after SARS-CoV-2 mRNA vaccination. name mentioned* literature_supp
36574772 Immunoglobulin germline gene polymorphisms influence the function of SARS-CoV-2 neutralizing antibodies. name mentioned* literature_supp
36827454 Modeling and predicting the overlap of B- and T-cell receptor repertoires in healthy and SARS-CoV-2 infected individuals. name mentioned* literature_supp
37368240 Memory B cell development elicited by mRNA booster vaccinations in the elderly. name mentioned* literature_supp
39627383 Novel polymorphic and copy number diversity in the antibody IGH locus of South African individuals. name mentioned* literature_supp
40066131 Characterization of Immunoglobulin Heavy Locus Rearrangements in Molecular Subtypes of Childhood B-Cell Precursor Acute Lymphoblastic Leukemia. name mentioned* literature_supp
41606257 Allergen-specific human IgE isolated through an allergen-agnostic pipeline-understanding immune response and allergen recognition. name mentioned* literature_supp
41617721 Refined phenotyping of vaccine responses reveals transcriptomic determinants of neutralizing antibody heterogeneity. name mentioned* literature_supp
42078068 B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies. name mentioned* literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by HUSA, IMGT, KIARVA, OGRDB. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

PartSequenceSourceRSS UID
v_rsCACAGTGAGGGGAGGCCATTGTGCGCCCAGACACAAACC HUSA IMGT HUMAN-R2EP6Z
v_rsCACAGTGAGGGGAGGCCATTGTGCTCCCAGACACAAACC HUSA HUMAN-R6RXTS

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)SplitSourceLeader UID
ATGGAGTTTGGGCTGAGCTGGGTTTTCCTTGTTGCTATTTTAAAAGGTGTCCAGTGT 46 + 11 nt HUSA IMGT HUMAN-LDYHPI

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/HUMAN-VR4KXPMTP/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

293 nt
GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTCCAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCGTCAGTAGCAACTACATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCTCAGTTATTTATAGCGGTGGTAGCACATACTACGCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTTCAAATGAACAGCCTGAGAGCTGAGGACACGGCTGTGTATTACTGTGCGAGAGA

Amino-acid sequence (V-REGION)

97 aa
EVQLVESGGGLVQPGGSLRLSCAASGFTVSSNYMSWVRQAPGKGLEWVSVIYSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR

Published by the source, and consistent with the nucleotide sequence above. i