AIRBabel immunoglobulin and T-cell receptor allele sequences · leaders · RSSs

← back to search

MOUSE-V435353VW

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesMus musculus LocusIGH TypeV FunctionalTrue Length252 nt

Earlier records of this allele i

IMGT has published this allele name over more than one sequence extent. Earlier sequence extents are deferred from default search results but remain resolvable, so a paper that cited one still leads here.

RecordNameLengthRelation to this recordIMGT releases
MOUSE-VNYONAINM IGHV1-64*02 252 nt bases differ 2013-01-20
SpeciesMus musculus (NCBITAXON:10090)
Locus / typeIGH / V
Functional iTrue
Length252 nt
Protein UID iMOUSE-VP-T3VUMD (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

Every name below denotes this exact sequence (MOUSE-V435353VW). None is canonical; they are labels, and the UID is the key.

NameSchemeSource(s)
IGHV1-64*02 IMGT IMGT

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

NameKindSource(s)
L26853.1 NCBI accession ncbi_nucleotide

External records i

NCBI nucleotide: link GenBank: GENBANK:L26853 GenBank: GENBANK:L26853.1 IMGT: IGHV1-64*02

Literature references 2 total · 1 verified · 1 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMIDTitleEvidenceSource
7991601 verified ncbi_nucleotide
39698082 Comprehensive method for producing high-affinity mouse monoclonal antibodies of various isotypes against (4-hydroxy-3-nitrophenyl)acetyl (NP) hapten. name mentioned* literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)SplitSourceLeader UID
ATGGGATGGAGCTATATCATCCTCTTTTTGGTAGCAACAGCTACAGGTGTCCACTCC 46 + 11 nt IMGT MOUSE-LRVLRZ

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/MOUSE-V435353VW/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

252 nt
CAGGTCCAACTGCAGCAGCCTGGGGCTGAGCTGGTAAAGCCTGGGGCTTCAGTGAAGTTGTCCTGCAAGGCTTCTGGCTACACTTTCACCAGCTACTGGATGCACTGGGTGAAGCAGAGGCCTGGACAAGGCCTTGAGTGGATTGGAATGATTCATCCTAATAGTGGTAGTACTAACTACAATGAGAAGTTCAAGAGCAAGGCCACACTGACTGTAGACAAATCCTCCAGCACAGCCTACATGCAACTCAGC

Amino-acid sequence (V-REGION)

84 aa
QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGQGLEWIGMIHPNSGSTNYNEKFKSKATLTVDKSSSTAYMQLS

Published by the source, and consistent with the nucleotide sequence above. i