AIRBabel immunoglobulin and T-cell receptor allele sequences · leaders · RSSs

← back to search

MOUSE-VNYONAINM

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

StatusArchived · seen 2013-01-20 SpeciesMus musculus LocusIGH TypeV FunctionalNone Length252 nt RecordSuperseded

A newer source record exists for this allele designation. IGHV1-64*02 is still published by IMGT as MOUSE-V435353VW, 252 nt, whose bases differ from this one. This is the earlier record (252 nt, current in IMGT releases 2013-01-20). The allele was not renamed and it was not withdrawn: IMGT changed the published sequence extent associated with this designation. Both extents are kept because a sequence is identified by its bases, so a change in extent is a different sequence.

SpeciesMus musculus (NCBITAXON:10090)
Locus / typeIGH / V
Functional iNone
Length252 nt
Protein UID iMOUSE-VP-6RHJU7 (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

None.

Former IMGT names i

Former nameLast seen in IMGT release
IGHV1-64*022013-01-20

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/MOUSE-VNYONAINM/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

252 nt
GAGGTCCAACTGCAGCAGCCTGGGGCTGAGCTGGTAAAGCCTGGGGCTTCAGTGAAGTTGTCCTGCAAGGCTTCTGGCTACACTTTCACCAGCTACTGGATGCACTGGGTGAAGCAGAGGCCTGGACAAGGCCTTGAGTGGATTGGAATGATTCATCCTAATAGTGGTAGTACTAACTACAATGAGAAGTTCAAGAGCAAGGCCACACTGACTGTAGACAAATCCTCCAGCACAGCCTACATGCAACTCAGC

Amino-acid sequence (V-REGION)

84 aa
EVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGQGLEWIGMIHPNSGSTNYNEKFKSKATLTVDKSSSTAYMQLS

Translated here from the nucleotide sequence; no source published a protein for this allele. i