AIRBabel immunoglobulin and T-cell receptor allele sequences · leaders · RSSs

← back to search

MOUSE-VF7QXBQJJ

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesMus musculus LocusIGH TypeV FunctionalTrue Length294 nt

Earlier records of this allele i

IMGT has published this allele name over more than one sequence extent. Earlier sequence extents are deferred from default search results but remain resolvable, so a paper that cited one still leads here.

RecordNameLengthRelation to this recordIMGT releases
MOUSE-V3NOCIPWV IGHV1-69*03 252 nt contained in this record 2013-01-20–2024-01-07
SpeciesMus musculus (NCBITAXON:10090)
Locus / typeIGH / V
Functional iTrue
Length294 nt
Protein UID iMOUSE-VP-2GF4IC (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

Every name below denotes this exact sequence (MOUSE-VF7QXBQJJ). None is canonical; they are labels, and the UID is the key.

NameSchemeSource(s)
IGHV1-69*03 IMGT IMGT

External records i

GenBank: GENBANK:IMGT000188 IMGT: IGHV1-69*03

Literature references 7 total · 7 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMIDTitleEvidenceSource
29558968 BALDR: a computational pipeline for paired heavy and light chain immunoglobulin reconstruction in single-cell RNA-seq data. name mentioned* literature_supp
32636395 IgCaller for reconstructing immunoglobulin gene rearrangements and oncogenic translocations from whole-genome sequencing in lymphoid neoplasms. name mentioned* literature_supp
34671351 Computational Inference, Validation, and Analysis of 5'UTR-Leader Sequences of Alleles of Immunoglobulin Heavy Chain Variable Genes. name mentioned* literature_supp
39698082 Comprehensive method for producing high-affinity mouse monoclonal antibodies of various isotypes against (4-hydroxy-3-nitrophenyl)acetyl (NP) hapten. name mentioned* literature_supp
40588565 Disease-specific U1 spliceosomal RNA mutations in mature B-cell neoplasms. name mentioned* literature_supp
41617721 Refined phenotyping of vaccine responses reveals transcriptomic determinants of neutralizing antibody heterogeneity. name mentioned* literature_supp
42078068 B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies. name mentioned* literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

PartSequenceSourceRSS UID
v_rsCACAGTGTTGCAACCACATCCTGAGAGTGTCAGAAACC IMGT MOUSE-RLLW2P

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)SplitSourceLeader UID
ATGGGATGGAGCTGTATCATCCTCTTCTTGGTATCAACAGCTACAGGTGTCCACTCC 46 + 11 nt IMGT MOUSE-LNW6ZC

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/MOUSE-VF7QXBQJJ/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

294 nt
CAGGTCCAACTGCAGCAGCCTGGGGCTGAGCTTGTGATGCCTGGGGCTTCAGTGAAGCTGTCCTGCAAGGCTTCTGGCTACACCTTCACCAGCTACTGGATGCACTGGGTGAAGCAGAGGCCTGGACAAGGCCTTGAGTGGATCGGAGAGATTGATCCTTCTGATAGTTATACTAACTACAATCAAAAGTTCAAGGGCAAGGCCACATTGACTGTAGACAAATCCTCCAGCACAGCCTACATGCAGCTCAGCAGCCTGACATCTGAGGACTCTGCGGTCTATTACTGTGCAAGA

Amino-acid sequence (V-REGION)

98 aa
QVQLQQPGAELVMPGASVKLSCKASGYTFTSYWMHWVKQRPGQGLEWIGEIDPSDSYTNYNQKFKGKATLTVDKSSSTAYMQLSSLTSEDSAVYYCAR

Published by the source, and consistent with the nucleotide sequence above. i