ORANGSUM-VIZHPKDUU

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesPongo abelii LocusIGH TypeV FunctionalTrue Length295 nt

Species	Pongo abelii (NCBITAXON:9601)
Locus / type	IGH / V
Functional i	True
Length	295 nt
Protein UID i	ORANGSUM-VP-7ZQEN2 (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

Every name below denotes this exact sequence (ORANGSUM-VIZHPKDUU). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGHV1-4*01	IMGT	IMGT

External records i

IMGT: IGHV1-4*01

Literature references 13 total · 1 sequence-in-paper · 12 name-mentioned* i

PubMed publications linked to this allele. A sequence-in-paper match indicates that this allele's exact sequence was detected in the publication text or supplementary material; it is sequence-level evidence. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
40205052	Complete sequencing of ape genomes.	sequence in paper	literature_supp
29545810	Repertoire Analysis of Antibody CDR-H3 Loops Suggests Affinity Maturation Does Not Typically Result in Rigidification.	name mentioned^*	literature_supp
34813501	B cell receptor isotypes differentially associate with cell signaling, kinetics, and outcome in chronic lymphocytic leukemia.	name mentioned^*	literature_supp
36473496	Antibody feedback regulates immune memory after SARS-CoV-2 mRNA vaccination.	name mentioned^*	literature_supp
36604758	Bacteroides-derived isovaleric acid enhances mucosal immunity by facilitating intestinal IgA response in broilers.	name mentioned^*	literature_supp
37938344	Role of affinity in plasma cell development in the germinal center light zone.	name mentioned^*	literature_supp
38567069	Diversification of immunoglobulin genes by gene conversion in the domestic chicken (Gallus gallus domesticus).	name mentioned^*	literature_supp
39127707	Covalent penicillin-protein conjugates elicit anti-drug antibodies that are clonally and functionally restricted.	name mentioned^*	literature_supp
39698082	Comprehensive method for producing high-affinity mouse monoclonal antibodies of various isotypes against (4-hydroxy-3-nitrophenyl)acetyl (NP) hapten.	name mentioned^*	literature_supp
41021799	Molecular divergence and convergence of mammalian antibody responses to the influenza virus hemagglutinin stem.	name mentioned^*	literature_supp
41410768	Convergent mutation trajectories convert functional self-tolerance in IGHV4-34 B cells to genetic tolerance encoded in the antibody.	name mentioned^*	literature_supp
41873331	Porcine influenza mAbs to H3, H5, and H7 hemagglutinins recognize H3 egg adapted site and target the HA stem.	name mentioned^*	literature_supp
41941497	Pigs lacking Natural Killer T cells have altered cellular responses to influenza.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CACAGTGTGAAAACCCACATCCTGAGAGTGTCAGAAACC	IMGT	ORANGSUM-RNTBEN

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATGGACTGGACCTGGAGGATCCTCTTCTTGGTGGCAGCAGCTACAGGTGCCCACTCC	46 + 11 nt	IMGT	ORANGSUM-LMJTFN

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/ORANGSUM-VIZHPKDUU/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

295 nt

CAGGTCCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAACCTGGGACCTCAGTGAAGATCTCCTGCAAGGCTTCTGGTTACACCTTCACCAGCTACTATATGCACTGGGTGCGACAGGCCCCTGGACAGGGGCTTGAGTGGATTGGACGGATCAACCCTAACAGTGGTAACACAAACTACGCACAGAAGTTTCAGGGCAGAGTCGCCATGACCAGGGACACGTCCATCAGCACAGCCTACATGGAGCTGAGAAGCCTGAGATCTGAGGACACAGCCACCTATTACTGTGGAGAGA

Amino-acid sequence (V-REGION)

98 aa

QVQLVQSGAEVKKPGTSVKISCKASGYTFTSYYMHWVRQAPGQGLEWIGRINPNSGNTNYAQKFQGRVAMTRDTSISTAYMELRSLRSEDTATYYCGE

Published by the source, and consistent with the nucleotide sequence above. i

API: JSON · AIRR AlleleDescription · aliases