ORANGSUM-VLKFMUJJD

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesPongo abelii LocusIGH TypeV FunctionalTrue Length299 nt

IGHV3-43*02: a Pongo abelii IGH V allele sequence, 299 nt, functional. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Pongo abelii (NCBITAXON:9601)
Locus / type	IGH / V
Functional i	True
Length	299 nt
Protein UID i	ORANGSUM-VP-SX6RO6 (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

299 nt

GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACGTTCAGTAACTACTACCTGCACTGGTTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCGCATATATTAGTAGTGGTAGTGGTGGTAGCACAAACTACCCAGATTCTGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCTGTGTATTACTGTGCGAGAGA

Amino-acid sequence (V-REGION)

99 aa

EVQLVESGGGLVQPGGSLRLSCAASGFTFSNYYLHWFRQAPGKGLEWVAYISSGSGGSTNYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAR

Published by the source, and consistent with the nucleotide sequence above. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (ORANGSUM-VLKFMUJJD). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGHV3-43*02	IMGT	IMGT

External records i

IMGT: IGHV3-43*02

Literature references 18 total · 1 sequence-in-paper · 17 name-mentioned* i

PubMed publications linked to this allele. A sequence-in-paper match indicates that this allele's exact sequence was detected in the publication text or supplementary material; it is sequence-level evidence. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
40205052	Complete sequencing of ape genomes.	sequence in paper	literature_supp
29545810	Repertoire Analysis of Antibody CDR-H3 Loops Suggests Affinity Maturation Does Not Typically Result in Rigidification.	name mentioned^*	literature_supp
29558968	BALDR: a computational pipeline for paired heavy and light chain immunoglobulin reconstruction in single-cell RNA-seq data.	name mentioned^*	literature_supp
31839985	More than one antibody of individual B cells revealed by single-cell immune profiling.	name mentioned^*	literature_supp
33048842	Antimalarial antibody repertoire defined by plasma IG proteomics and single B cell IG sequencing.	name mentioned^*	literature_supp
33485405	Enhancement versus neutralization by SARS-CoV-2 antibodies from a convalescent donor associates with distinct epitopes on the RBD.	name mentioned^*	literature_supp
34614412	mRNA vaccination of naive and COVID-19-recovered individuals elicits potent memory B cells that recognize SARS-CoV-2 variants.	name mentioned^*	literature_supp
34785098	Landscapes and dynamic diversifications of B-cell receptor repertoires in COVID-19 patients.	name mentioned^*	literature_supp
36328595	Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing.	name mentioned^*	literature_supp
36473496	Antibody feedback regulates immune memory after SARS-CoV-2 mRNA vaccination.	name mentioned^*	literature_supp
36827454	Modeling and predicting the overlap of B- and T-cell receptor repertoires in healthy and SARS-CoV-2 infected individuals.	name mentioned^*	literature_supp
36874132	Characterization of clonal immunoglobulin heavy V-D-J gene rearrangements in Chinese patients with chronic lymphocytic leukemia: Clinical features and molecular profiles.	name mentioned^*	literature_supp
37368240	Memory B cell development elicited by mRNA booster vaccinations in the elderly.	name mentioned^*	literature_supp
37533642	TRAPnSeq allows high-throughput profiling of antigen-specific antibody-secreting cells.	name mentioned^*	literature_supp
39189763	Evaluation of human antibodies from vaccinated volunteers for protection against Yersinia pestis infection.	name mentioned^*	literature_supp
39840032	An allelic atlas of immunoglobulin heavy chain variable regions reveals antibody binding epitope preference resilient to SARS-CoV-2 mutation escape.	name mentioned^*	literature_supp
41617721	Refined phenotyping of vaccine responses reveals transcriptomic determinants of neutralizing antibody heterogeneity.	name mentioned^*	literature_supp
42078068	B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CACAGTGAGGGGAAGTCAGTGTGAGCCCAGACACAAACC	IMGT	ORANGSUM-REXGWW

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATGGAGTTTGGGCTGAGCTGGGTTTTTCTTGTGGCTATTTTAAAAGGTGTCCAGTGT	46 + 11 nt	IMGT	ORANGSUM-LUXZZQ

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/ORANGSUM-VLKFMUJJD/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases